PRGDB00050695 (disease resistance protein-like protein MsR1)

From PRG Wiki
Jump to: navigation, search
disease resistance protein-like protein MsR1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 34391518 (AY145085)
Gene Class CNL
Domain Type LRR, NBS, Ser-Thr Kinase, Ser-Thr Kinase, Others
Gene Species Medicago sativa

Comment?

Medicago sativa disease resistance protein-like protein MsR1 mRNA, complete cds.

DNA Sequence

ATGAGTAGCGCCACACATATTATTACCCTTGCAACAAGATTTCAATTTCATGATGTCTTGAACAAAATATCTCAAATTGCTGAAAAAGCACAAGAGAACCAAAGTTCAAGGCGATCGTTGAGATTAATCTTAAGGAATTTATCTCCCGTTGTACAAGATATAAAGCAATACAATGATCATTTGGATCACCCCAGAGAAGAAATAAATAGTTTGATAGAAGAAAATGATGCAGAAGAAAGTGCATGCAAATGTTCTTCTGAGAATGATTCCAATGTGGTTGAGAAGCTCAAGAATGAAACTTTTGAAGCTGGACCACCTTTCAAGTGTCCTTTTGATGTTCCTGAAAATCCAAAATTCACTGTTGGGTTGGATATACCATTTAGCAAGTTGAAAATGGAGCTTTTAAGGGATGGTAGTTCCACCCTTGTGTTGACTGGCTTAGGAGGATTGGGGAAGACCACTTTGGCTACTAAGCTTTGTTGGGATCAAGAAGTTAATGGTAAATTCATGGAAAACATTATATTTGTCACCTTCTCAAAAACACCCATGTTGAAGACTATTGTAGAGAGAATACATGAACATTGTGGATATCCAGTACCTGAGTTTCAAAATGATGAAGATGCTGTCAATAGGTTAGGACTTCTGTTGAAGAAAGTTGAGGGAAGTCCATTATTGTTGGTTCTGGATGATGTTTGGCCAAGCTCAGAATCCCTTGTTGAGAAACTTCAATTCCAGATATCAGATTTCAAAATTCTGGTGACTTCAAGGGTTGCATTTCCAAGGTTTAGCACAACATGTATCCTAAAACCTCTTGCTCATGAAGACGCAGTAACGCTTTTCCATCACTATGCTCTGATGGAAAAAAATAGTTCAGATATTATCGACAAAAATCTTGTCGAAAAGGTCGTTAGAAGTTGCCAAGGTTTACCGCTTACCATTAAAGTAATTGCTACATCGCTAAAAAATCGGCCTCATGACTTGTGGCGTAAGATAGTGAAGGAACTGTCACAAGGTCATTCTATTCTTGATTCTAATACCGAATTACTTACTCGCCTCCAAAAGATCTTCGATGTTTTGGAAGATAATCCCACAATCATTGAGTGCTTCATGGACCTAGCCTTATTTCCCGAAGACCATAGAATTCCTGTCGCTGCTCTCGTTGATATGTGGGCAGAGCTGTATAGACTAGATGACACCGGAATACAAGCAATGGAAATCATCAACAAATTAGGCATCATGAATTTGGCTAATGTCATAATACCAAGGAAAGATGCAAGTGACACAGACAATAACAACTACAATAATCACTTCATCATGCTTCATGATATTCTAAGAGAACTTGGAATTTACCGAAGCACCAAGGAACCATTTGAGCAGAGAAAAAGACTGATTATTGACATGCATAAAAATAAAAGTGGGCTCACGGAGAAGCAACAAGGCTTGATGATCCGTATATTGTCAAAGTTTATGAGATTGTGTGTTAAACAGAATCCTCAACAGCTCGCTGCCCGTATATTGTCGGTATCAACTGATGAAACATGTGCGTTGGATTGGTCTCAAATGGAACCAGCTCAGGTTGAGGTTCTGATTTTAAATCTTCATACCAAGCAGTACTCATTACCCGAGTGGATTGGAAAAATGAGTAAACTAAAAGTTCTGATAATCACAAACTACACTGTCCATCCTTCTGAACTGACCAACTTTGAGCTTCTCAGTTCTTTACAGAATCTGGAAAAAATTAGACTAGAGCGAATTTCCGTTCCTTCGTTCGCCACAGTAAAGAATCTGAAAAAACTATCGCTCTACATGTGTAATACAAGACTGGCTTTTGAAAAAGGTAGCATCCTAATTTCAGATGCATTTCCAAATTTAGAAGAATTGAACATTGATTACTGCAAAGATTTGTTGGTATTGCCAACTGGTATCTGTGATATCATCTCACTAAAGAAGCTCAGTGTTACTAATTGCCACAAGATTTCTTCACTTCCTGAAGATATTGGAAAATTGGAGAATTTGGAACTTCTAAGCCTCAGTTCATGTACTGACTTGGAAGCTATACCGACTTCCATTGAAAAGCTGTTAAATCTAAAACATCTTGACATTTCAACTGCGTAA


Protein sequences

Name Description Sequence
disease resistance protein-like protein MsR1 disease resistance protein-like protein MsR1 [Medicago sativa].

MSSATHIITLATRFQFHDVLNKISQIAEKAQENQSSRRSLRLILRNLSPVVQDIKQYNDHLDHPREEINSLIEENDAEESACKCSSENDSNVVEKLKNETFEAGPPFKCPFDVPENPKFTVGLDIPFSKLKMELLRDGSSTLVLTGLGGLGKTTLATKLCWDQEVNGKFMENIIFVTFSKTPMLKTIVERIHEHCGYPVPEFQNDEDAVNRLGLLLKKVEGSPLLLVLDDVWPSSESLVEKLQFQISDFKILVTSRVAFPRFSTTCILKPLAHEDAVTLFHHYALMEKNSSDIIDKNLVEKVVRSCQGLPLTIKVIATSLKNRPHDLWRKIVKELSQGHSILDSNTELLTRLQKIFDVLEDNPTIIECFMDLALFPEDHRIPVAALVDMWAELYRLDDTGIQAMEIINKLGIMNLANVIIPRKDASDTDNNNYNNHFIMLHDILRELGIYRSTKEPFEQRKRLIIDMHKNKSGLTEKQQGLMIRILSKFMRLCVKQNPQQLAARILSVSTDETCALDWSQMEPAQVEVLILNLHTKQYSLPEWIGKMSKLKVLIITNYTVHPSELTNFELLSSLQNLEKIRLERISVPSFATVKNLKKLSLYMCNTRLAFEKGSILISDAFPNLEELNIDYCKDLLVLPTGICDIISLKKLSVTNCHKISSLPEDIGKLENLELLSLSSCTDLEAIPTSIEKLLNLKHLDISTA

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
108-335 SSF52540

KCPFDVPENPKFTVGLDIPFSKLKMELLRDGSSTLVLTGLGGLGKTTLATKLCWDQEVNGKFMENIIFVTFSKTPMLKTIVERIHEHCGYPVPEFQNDEDAVNRLGLLLKKVEGSPLLLVLDDVWPSSESLVEKLQFQISDFKILVTSRVAFPRFSTTCILKPLAHEDAVTLFHHYALMEKNSSDIIDKNLVEKVVRSCQGLPLTIKVIATSLKNRPHDLWRKIVKEL

HMMPanther: PTHR23155:SF239
118-702 PTHR23155:SF239,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

KFTVGLDIPFSKLKMELLRDGSSTLVLTGLGGLGKTTLATKLCWDQEVNGKFMENIIFVTFSKTPMLKTIVERIHEHCGYPVPEFQNDEDAVNRLGLLLKKVEGSPLLLVLDDVWPSSESLVEKLQFQISDFKILVTSRVAFPRFSTTCILKPLAHEDAVTLFHHYALMEKNSSDIIDKNLVEKVVRSCQGLPLTIKVIATSLKNRPHDLWRKIVKELSQGHSILDSNTELLTRLQKIFDVLEDNPTIIECFMDLALFPEDHRIPVAALVDMWAELYRLDDTGIQAMEIINKLGIMNLANVIIPRKDASDTDNNNYNNHFIMLHDILRELGIYRSTKEPFEQRKRLIIDMHKNKSGLTEKQQGLMIRILSKFMRLCVKQNPQQLAARILSVSTDETCALDWSQMEPAQVEVLILNLHTKQYSLPEWIGKMSKLKVLIITNYTVHPSELTNFELLSSLQNLEKIRLERISVPSFATVKNLKKLSLYMCNTRLAFEKGSILISDAFPNLEELNIDYCKDLLVLPTGICDIISLKKLSVTNCHKISSLPEDIGKLENLELLSLSSCTDLEAIPTSIEKLLNLKHLDIS

HMMPanther: PTHR23155
118-702 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KFTVGLDIPFSKLKMELLRDGSSTLVLTGLGGLGKTTLATKLCWDQEVNGKFMENIIFVTFSKTPMLKTIVERIHEHCGYPVPEFQNDEDAVNRLGLLLKKVEGSPLLLVLDDVWPSSESLVEKLQFQISDFKILVTSRVAFPRFSTTCILKPLAHEDAVTLFHHYALMEKNSSDIIDKNLVEKVVRSCQGLPLTIKVIATSLKNRPHDLWRKIVKELSQGHSILDSNTELLTRLQKIFDVLEDNPTIIECFMDLALFPEDHRIPVAALVDMWAELYRLDDTGIQAMEIINKLGIMNLANVIIPRKDASDTDNNNYNNHFIMLHDILRELGIYRSTKEPFEQRKRLIIDMHKNKSGLTEKQQGLMIRILSKFMRLCVKQNPQQLAARILSVSTDETCALDWSQMEPAQVEVLILNLHTKQYSLPEWIGKMSKLKVLIITNYTVHPSELTNFELLSSLQNLEKIRLERISVPSFATVKNLKKLSLYMCNTRLAFEKGSILISDAFPNLEELNIDYCKDLLVLPTGICDIISLKKLSVTNCHKISSLPEDIGKLENLELLSLSSCTDLEAIPTSIEKLLNLKHLDIS

HMMPfam: PF00931
IPR002182
130-392 NB-ARC,NBS
NB-ARC

LKMELLRDGSSTLVLTGLGGLGKTTLATKLCWDQEVNGKFMENIIFVTFSKTPMLKTIVERIHEHCGYPVPEFQNDEDAVNRLGLLLKKVEGSPLLLVLDDVWPSSESLVEKLQFQISDFKILVTSRVAFPRFSTTCILKPLAHEDAVTLFHHYALMEKNSSDIIDKNLVEKVVRSCQGLPLTIKVIATSLKNRPHDLWRKIVKELSQGHSILDSNTELLTRLQKIFDVLEDNPTIIECFMDLALFPEDHRIPVAALVDMWAE

Gene3D: G3DSA:3.40.50.300
136-244 G3DSA:3.40.50.300

RDGSSTLVLTGLGGLGKTTLATKLCWDQEVNGKFMENIIFVTFSKTPMLKTIVERIHEHCGYPVPEFQNDEDAVNRLGLLLKKVEGSPLLLVLDDVWPSSESLVEKLQF

FPrintScan: PR00364
IPR000767
141-156 DISEASERSIST
Disease resistance protein

TLVLTGLGGLGKTTLA

FPrintScan: PR00364
IPR000767
218-232 DISEASERSIST
Disease resistance protein

KVEGSPLLLVLDDVW

FPrintScan: PR00364
IPR000767
306-320 DISEASERSIST
Disease resistance protein

CQGLPLTIKVIATSL

Gene3D: G3DSA:3.80.10.10
531-702 G3DSA:3.80.10.10

LNLHTKQYSLPEWIGKMSKLKVLIITNYTVHPSELTNFELLSSLQNLEKIRLERISVPSFATVKNLKKLSLYMCNTRLAFEKGSILISDAFPNLEELNIDYCKDLLVLPTGICDIISLKKLSVTNCHKISSLPEDIGKLENLELLSLSSCTDLEAIPTSIEKLLNLKHLDIS

superfamily: SSF52047
539-702 SSF52047,LRR

SLPEWIGKMSKLKVLIITNYTVHPSELTNFELLSSLQNLEKIRLERISVPSFATVKNLKKLSLYMCNTRLAFEKGSILISDAFPNLEELNIDYCKDLLVLPTGICDIISLKKLSVTNCHKISSLPEDIGKLENLELLSLSSCTDLEAIPTSIEKLLNLKHLDIS

FPrintScan: PR00364
IPR000767
667-683 DISEASERSIST
Disease resistance protein

GKLENLELLSLSSCTDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox