PRGDB00050698 (At5g25910)

From PRG Wiki
Jump to: navigation, search
At5g25910
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32189308 (BT009659)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At5g25910 mRNA, complete cds.

DNA Sequence

ATGACTTTTTTACCCTTACTTTTCATCTTCTTCTTCCTCACATCAATACCCTTTCCCGCCTTTTCCCAGTACAACGACCGGTCAACGCTGCTAAACCTGAAACGCGATCTCGGCGACCCATTGTCTCTCCGGCTATGGAACGACACATCTTCACCGTGCAATTGGCCAAGGATTACCTGCACCGCCGGAAACGTCACCGAGATAAACTTCCAGAACCAGAACTTCACCGGGACAGTTCCAACGACGATTTGCAACTTCCCGAATCTCAAATCCCTAAATTTGTCGTTTAATTACTTCGCCGGTGAGTTTCCAACGGTTCTTTACAATTGCACGAAGCTTCAATACCTCGATCTCTCTCAGAACCTATTCAACGGCTCACTTCCCGACGACATCAACCGTCTCGCACCTAAACTTAAGTATCTCGATCTCGCGGCTAACTCCTTTGCCGGAGATATCCCAAAAAACATCGGACGGATCTCGAAGCTCAAGGTATTAAACCTCTACATGAGCGAATACGACGGTACGTTTCCATCGGAGATCGGAGACTTATCGGAGCTTGAAGAACTTCAATTAGCTTTAAACGATAAGTTTACGCCGGTGAAGCTTCCAACGGAGTTTGGGAAACTGAAGAAATTGAAGTACATGTGGTTAGAGGAGATGAATCTGATCGGAGAAATCTCAGCCGTTGTTTTCGAGAACATGACGGATCTTAAACACGTAGACTTATCGGTCAACAATTTAACGGGTCGGATCCCTGACGTTTTATTCGGGCTGAAGAATCTCACCGAGCTTTATCTCTTTGCAAATGACTTAACCGGAGAAATCCCGAAATCAATTTCGGCGAAGAACTTGGTACATCTTGATCTCTCCGCTAACAATTTAAACGGTTCCATTCCGGAATCAATCGGAAATCTAACGAATTTAGAGCTTTTGTATCTCTTTGTCAACGAGTTAACCGGAGAAATCCCACGGGCTATCGGAAAATTACCGGAACTGAAGGAGCTGAAACTCTTTACCAACAAGTTAACCGGAGAAATACCGGCAGAGATTGGGTTTATTTCGAAGCTAGAGCGGTTCGAAGTTTCGGAGAATCAGTTAACCGGAAAGTTACCGGAGAATTTGTGTCACGGAGGTAAACTTCAAAGTGTGATTGTGTACTCGAACAATCTCACCGGAGAAATCCCAGAGTCTCTAGGAGATTGTGAGACACTCTCGTCGGTTCTGTTACAGAACAATGGCTTCTCTGGCTCAGTTACTATATCAAACAACACGCGTGAATCTTTCGAACAACACTTTCACCGGTTTCAAAAGATTAACGAAATCTACCGTGCAACCATCTATGAGTGA


Protein sequences

Name Description Sequence
At5g25910 At5g25910 [Arabidopsis thaliana].

MTFLPLLFIFFFLTSIPFPAFSQYNDRSTLLNLKRDLGDPLSLRLWNDTSSPCNWPRITCTAGNVTEINFQNQNFTGTVPTTICNFPNLKSLNLSFNYFAGEFPTVLYNCTKLQYLDLSQNLFNGSLPDDINRLAPKLKYLDLAANSFAGDIPKNIGRISKLKVLNLYMSEYDGTFPSEIGDLSELEELQLALNDKFTPVKLPTEFGKLKKLKYMWLEEMNLIGEISAVVFENMTDLKHVDLSVNNLTGRIPDVLFGLKNLTELYLFANDLTGEIPKSISAKNLVHLDLSANNLNGSIPESIGNLTNLELLYLFVNELTGEIPRAIGKLPELKELKLFTNKLTGEIPAEIGFISKLERFEVSENQLTGKLPENLCHGGKLQSVIVYSNNLTGEIPESLGDCETLSSVLLQNNGFSGSVTISNNTRESFEQHFHRFQKINEIYRATIYE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF500
1-425 PTHR26393:SF500

MTFLPLLFIFFFLTSIPFPAFSQYNDRSTLLNLKRDLGDPLSLRLWNDTSSPCNWPRITCTAGNVTEINFQNQNFTGTVPTTICNFPNLKSLNLSFNYFAGEFPTVLYNCTKLQYLDLSQNLFNGSLPDDINRLAPKLKYLDLAANSFAGDIPKNIGRISKLKVLNLYMSEYDGTFPSEIGDLSELEELQLALNDKFTPVKLPTEFGKLKKLKYMWLEEMNLIGEISAVVFENMTDLKHVDLSVNNLTGRIPDVLFGLKNLTELYLFANDLTGEIPKSISAKNLVHLDLSANNLNGSIPESIGNLTNLELLYLFVNELTGEIPRAIGKLPELKELKLFTNKLTGEIPAEIGFISKLERFEVSENQLTGKLPENLCHGGKLQSVIVYSNNLTGEIPESLGDCETLSSVLLQNNGFSGSVTISNNTR

HMMPanther: PTHR26393
1-425 PTHR26393,FAMILY NOT NAMED

MTFLPLLFIFFFLTSIPFPAFSQYNDRSTLLNLKRDLGDPLSLRLWNDTSSPCNWPRITCTAGNVTEINFQNQNFTGTVPTTICNFPNLKSLNLSFNYFAGEFPTVLYNCTKLQYLDLSQNLFNGSLPDDINRLAPKLKYLDLAANSFAGDIPKNIGRISKLKVLNLYMSEYDGTFPSEIGDLSELEELQLALNDKFTPVKLPTEFGKLKKLKYMWLEEMNLIGEISAVVFENMTDLKHVDLSVNNLTGRIPDVLFGLKNLTELYLFANDLTGEIPKSISAKNLVHLDLSANNLNGSIPESIGNLTNLELLYLFVNELTGEIPRAIGKLPELKELKLFTNKLTGEIPAEIGFISKLERFEVSENQLTGKLPENLCHGGKLQSVIVYSNNLTGEIPESLGDCETLSSVLLQNNGFSGSVTISNNTR

HMMPfam: PF08263
IPR013210
25-60 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NDRSTLLNLKRDLGDPLSLRLWNDTSSPCNWPRITC

Gene3D: G3DSA:3.80.10.10
26-195 G3DSA:3.80.10.10

DRSTLLNLKRDLGDPLSLRLWNDTSSPCNWPRITCTAGNVTEINFQNQNFTGTVPTTICNFPNLKSLNLSFNYFAGEFPTVLYNCTKLQYLDLSQNLFNGSLPDDINRLAPKLKYLDLAANSFAGDIPKNIGRISKLKVLNLYMSEYDGTFPSEIGDLSELEELQLALND

superfamily: SSF52058
29-425 SSF52058,LRR

TLLNLKRDLGDPLSLRLWNDTSSPCNWPRITCTAGNVTEINFQNQNFTGTVPTTICNFPNLKSLNLSFNYFAGEFPTVLYNCTKLQYLDLSQNLFNGSLPDDINRLAPKLKYLDLAANSFAGDIPKNIGRISKLKVLNLYMSEYDGTFPSEIGDLSELEELQLALNDKFTPVKLPTEFGKLKKLKYMWLEEMNLIGEISAVVFENMTDLKHVDLSVNNLTGRIPDVLFGLKNLTELYLFANDLTGEIPKSISAKNLVHLDLSANNLNGSIPESIGNLTNLELLYLFVNELTGEIPRAIGKLPELKELKLFTNKLTGEIPAEIGFISKLERFEVSENQLTGKLPENLCHGGKLQSVIVYSNNLTGEIPESLGDCETLSSVLLQNNGFSGSVTISNNTR

HMMPfam: PF13855
87-147 LRR_8,Leucine rich repeat

PNLKSLNLSFNYFAGEFPTVLYNCTKLQYLDLSQNLFNGSLPDDINRLAPKLKYLDLAANS

Gene3D: G3DSA:3.80.10.10
201-421 G3DSA:3.80.10.10

KLPTEFGKLKKLKYMWLEEMNLIGEISAVVFENMTDLKHVDLSVNNLTGRIPDVLFGLKNLTELYLFANDLTGEIPKSISAKNLVHLDLSANNLNGSIPESIGNLTNLELLYLFVNELTGEIPRAIGKLPELKELKLFTNKLTGEIPAEIGFISKLERFEVSENQLTGKLPENLCHGGKLQSVIVYSNNLTGEIPESLGDCETLSSVLLQNNGFSGSVTIS

HMMPfam: PF13855
211-271 LRR_8,Leucine rich repeat

KLKYMWLEEMNLIGEISAVVFENMTDLKHVDLSVNNLTGRIPDVLFGLKNLTELYLFANDL

HMMPfam: PF12799
282-319 LRR_4,Leucine Rich repeats (2 copies)

KNLVHLDLSANNLNGSIPESIGNLTNLELLYLFVNELT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox