PRGDB00050702 (NBS-LRR-like protein CR274)

From PRG Wiki
Jump to: navigation, search
NBS-LRR-like protein CR274
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 31616480 (AY310366)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) NBS-LRR-like protein CR274 gene, partial cds.

DNA Sequence

GGGATGGGGGGGCTGGGGAAAACGACTCTGGCTAAGCTAGTCTTCAACAACTCAACAGTGTCAAAGCATTTTGACGTTCTGTTATGGGTTTATGTATCTGTTCACTTCGATCAAAATAAGATTATGCAGGAAATGTTGGACTCCTTTTGCGGGGATGAGCATGATGAAATCAAGAAATCGAAGGAGCTTCAACTCCAAGACAAACTTGACTACTTATTGAAGTCAAAACGAGTGCTACTTGTTATGGATGACATGTGGGAGGATAGCACAAAGGAAAAATGGGATGAGCTGTTAAATCCATTGCTTAAAAACGATGTTATGGGGAACAGTGTTCTTGTCACAACTCGTAAACCATCTGTGGCAACAATGATAGAAGCAGCAGATCACATCAACCTGGATGGTTTGAAAAAAGATGACTTTTGGTGTTTGTTCAAGGAATGTGTATTTGGACATGAGAACTATAAAGGAGAACCAAGACTGGAAAAAATTGGGCAGCAGATAGTTGACAAGTTAAAGGGCAATCCCCTCGCCGC


Protein sequences

Name Description Sequence
NBS-LRR-like protein CR274 NBS-LRR-like protein CR274 [Oryza sativa (indica cultivar-group)].

GMGGLGKTTLAKLVFNNSTVSKHFDVLLWVYVSVHFDQNKIMQEMLDSFCGDEHDEIKKSKELQLQDKLDYLLKSKRVLLVMDDMWEDSTKEKWDELLNPLLKNDVMGNSVLVTTRKPSVATMIEAADHINLDGLKKDDFWCLFKECVFGHENYKGEPRLEKIGQQIVDKLKGNPLAA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-178 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGLGKTTLAKLVFNNSTVSKHFDVLLWVYVSVHFDQNKIMQEMLDSFCGDEHDEIKKSKELQLQDKLDYLLKSKRVLLVMDDMWEDSTKEKWDELLNPLLKNDVMGNSVLVTTRKPSVATMIEAADHINLDGLKKDDFWCLFKECVFGHENYKGEPRLEKIGQQIVDKLKGNPLAA

HMMPfam: PF00931
IPR002182
1-177 NB-ARC,NBS
NB-ARC

GMGGLGKTTLAKLVFNNSTVSKHFDVLLWVYVSVHFDQNKIMQEMLDSFCGDEHDEIKKSKELQLQDKLDYLLKSKRVLLVMDDMWEDSTKEKWDELLNPLLKNDVMGNSVLVTTRKPSVATMIEAADHINLDGLKKDDFWCLFKECVFGHENYKGEPRLEKIGQQIVDKLKGNPLA

superfamily: SSF52540
1-177 SSF52540

GMGGLGKTTLAKLVFNNSTVSKHFDVLLWVYVSVHFDQNKIMQEMLDSFCGDEHDEIKKSKELQLQDKLDYLLKSKRVLLVMDDMWEDSTKEKWDELLNPLLKNDVMGNSVLVTTRKPSVATMIEAADHINLDGLKKDDFWCLFKECVFGHENYKGEPRLEKIGQQIVDKLKGNPLA

HMMPanther: PTHR11017:SF28
1-178 PTHR11017:SF28

GMGGLGKTTLAKLVFNNSTVSKHFDVLLWVYVSVHFDQNKIMQEMLDSFCGDEHDEIKKSKELQLQDKLDYLLKSKRVLLVMDDMWEDSTKEKWDELLNPLLKNDVMGNSVLVTTRKPSVATMIEAADHINLDGLKKDDFWCLFKECVFGHENYKGEPRLEKIGQQIVDKLKGNPLAA

Gene3D: G3DSA:3.40.50.300
4-114 G3DSA:3.40.50.300

GLGKTTLAKLVFNNSTVSKHFDVLLWVYVSVHFDQNKIMQEMLDSFCGDEHDEIKKSKELQLQDKLDYLLKSKRVLLVMDDMWEDSTKEKWDELLNPLLKNDVMGNSVLVT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox