PRGDB00050704 (NBS-LRR-like protein CR273)

From PRG Wiki
Jump to: navigation, search
NBS-LRR-like protein CR273
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 31616476 (AY310364)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) NBS-LRR-like protein CR273 gene, partial cds.

DNA Sequence

GGGATGGGGGGGATGGGGAAGACGACGCTTGCTAGATTTGTATACCATGATCAAAGAATTAAAGATCATTTTGATTTGCGAATGTGGGTTTGTGTATCCGATAATTTCAATGAGAAGAGCCTAACACGTGAGATTTTAGAGCATGTGTGTAAAGATAGACAAGGCTATGAAAATATAATCGGTTTAGGTGCACTGCAGGATACCCTTTTGGAGAATATTAGATGCAAAAGATTTCTGCTTGTATTGGATGATATGTGGGAAGATGGGGACATGAGTGGATGGGATAATCTGTTAGCTCCATTCAAATGTAATGAAGCAACCGGCTGCATGATTTTAGTGACAACTCGAAGGACATCAGTTGCAAAAAGGATAGGAACAGTGAACAAGGTTGAAGTGAATGGTCTGGATGAAACAGAGTTTTGGTTGCTCTTCAAGGCATGGGCATTTAATGGTTATGAGAACCTGGAGCTTGATCCATTTTTTCAATCCACTGGGAAAGACATTGCTAGAGAACTAAAGGGCAATCCCCTCGCCGC


Protein sequences

Name Description Sequence
NBS-LRR-like protein CR273 NBS-LRR-like protein CR273 [Oryza sativa (indica cultivar-group)].

GMGGMGKTTLARFVYHDQRIKDHFDLRMWVCVSDNFNEKSLTREILEHVCKDRQGYENIIGLGALQDTLLENIRCKRFLLVLDDMWEDGDMSGWDNLLAPFKCNEATGCMILVTTRRTSVAKRIGTVNKVEVNGLDETEFWLLFKAWAFNGYENLELDPFFQSTGKDIARELKGNPLAA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-179 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGMGKTTLARFVYHDQRIKDHFDLRMWVCVSDNFNEKSLTREILEHVCKDRQGYENIIGLGALQDTLLENIRCKRFLLVLDDMWEDGDMSGWDNLLAPFKCNEATGCMILVTTRRTSVAKRIGTVNKVEVNGLDETEFWLLFKAWAFNGYENLELDPFFQSTGKDIARELKGNPLAA

HMMPanther: PTHR11017:SF28
1-179 PTHR11017:SF28

GMGGMGKTTLARFVYHDQRIKDHFDLRMWVCVSDNFNEKSLTREILEHVCKDRQGYENIIGLGALQDTLLENIRCKRFLLVLDDMWEDGDMSGWDNLLAPFKCNEATGCMILVTTRRTSVAKRIGTVNKVEVNGLDETEFWLLFKAWAFNGYENLELDPFFQSTGKDIARELKGNPLAA

HMMPfam: PF00931
IPR002182
1-178 NB-ARC,NBS
NB-ARC

GMGGMGKTTLARFVYHDQRIKDHFDLRMWVCVSDNFNEKSLTREILEHVCKDRQGYENIIGLGALQDTLLENIRCKRFLLVLDDMWEDGDMSGWDNLLAPFKCNEATGCMILVTTRRTSVAKRIGTVNKVEVNGLDETEFWLLFKAWAFNGYENLELDPFFQSTGKDIARELKGNPLA

superfamily: SSF52540
1-170 SSF52540

GMGGMGKTTLARFVYHDQRIKDHFDLRMWVCVSDNFNEKSLTREILEHVCKDRQGYENIIGLGALQDTLLENIRCKRFLLVLDDMWEDGDMSGWDNLLAPFKCNEATGCMILVTTRRTSVAKRIGTVNKVEVNGLDETEFWLLFKAWAFNGYENLELDPFFQSTGKDIAR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox