PRGDB00050711 (putative RGA protein 567B-3.2)

From PRG Wiki
Jump to: navigation, search
putative RGA protein 567B-3.2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30023638 (AY123940)
Gene Class NL
Domain Type LRR, NBS
Gene Species Aegilops tauschii

Comment?

Aegilops tauschii putative RGA protein 567B-3.2 gene, partial cds.

DNA Sequence

AAATTAGCTATGATTGCCTCCCTTTTGATCTGAAGAAATGTTTTTCCTATTGTGGCCTTTTCCCCGAAGATCATTGGTTTACTTCTTCAGAAATCAATCATTTCTGGGTTGCAGTAGGCATCATAGACTCTGATCACCAAGCCGATAGGAATTACCTGGAAGAGCTAGTGGACAATGGTTTTCTCATGAAGCAATTCGATTGGCGTGATCGATGGTGGTATGTAATGCATGATTTAATGCATGAGCTATCTAAGAGTGTTTCTGCACAAGAATGCCACAATATAAGTGGCTTTGATTTCAGAGCTGATGCCATCTCGCAATCTGTTCGGCACTTATCTATCAACATAGAAGACAGATATGATGCAAATTTTGAGAAAGAAATGTGTAAACTAAGGGAGAGGATAGACATTGCTAATCTGCGGACTTTGATGATTTGTAGAAGATATGAAGAAGAAAGAATTGCCAAGATTTTGAAAGATAGCTTCAAGGAAATAAATAGTCTGCGTGTCCTATTTATAGCAGTGAGTACTCCAGAATCTTTTCCATATAGGTTTTCAAAACTGATCCACCTCCAGTACCTCAAAATTAGTTCATCTTACAAAGACGGTGAAATCAGTTTACCTAGTACACTATCAAGATTTTATCACTTGAAATTCCTGGACCTAGATGATTGGAATGGTCGTTCTGATTTACCTGAAGACTTCAGCCACCTTGAGAATTTACATGATTTCCGTGCTGGAAGTGAACTCCACTCCAATATTCGCAATGTTGGAAAGATGAAGCATCTGCAGGAGCTAAAAGAATTCCATGTCAGGAAGGAGAGCATGGGATTTGAACTGTCAGAACTTGGGGCATTGTCAGAGCTTGAAGAAGAACTGACTGTACTTGGTCTTGAACACGTGGCAACCAAGGAGGAAGCTACTGCAGCCAAACTGATGTTGAAAAGGAATCTGAAGCAGTTGGAATTACTCTGGTCAGGCAGAGATGGCCCAACTACAGATGCTGGTATTCTTGATGCTCTTCAACCACACTCTAATCTTAGAGTACTTACAATTGCAAATCATGGTGGTACTGTTGGTCCTAGTTGGTTGTGTCTTGACATGTGGTTAACAAGGTTAGAGACTCTCATTCTAGAAGGCATATCATGGAGCACCCTCCCACCTTTTGGGACACTGCCAAATCTCAAGGGACTCAAATTGAAGAAAATTTCTGGAATGCATCAGTTTGGGAAATGTTGTATGCGCTTGAAGACAGTTGAGTTTTATGAGATTCCAGAACTTGCTGAATGGCCCGTGGAACCTAAATGCCATTCCTTTCCAAGTATTGAAGAAATCAAATGCATCGATTGTCCCAACCTCCGTGTGATGCCCTTCTCGGAGGTATCTTGCACCAATTTGCGCAGACTTGAAGTTTCTGGGTGCCCCAAGATGTCTCTGCCCTCCATGCCTTACACCTCCACACTGACAAGTTGTGATGTTAAAAGATGTGATTCCGAAAGGTTGCTTTATGATGGAAAGGAACTGGTTGTTAGTGGGTATGGTGGTGCTTTGACCTTCCACAATCTGGATAAAGTAGAAGATATGACTGTCGGAAAATGCGACGGTTTGTTCCCTCAAGAGCTGGATGACAGTTTTGTCTTCCATTCAGTTGAGAGTCTCAAATTAGATGTGTCTCATCTTACCAGCAGCAAATCATCACCGTCAAAAGTGTTAAACTGTTTCCCAGCTCTTTCTGTGTTGCACATAGATGGCTGTGAGGAATGTGTAATGCAGTTCCCATCATCCAGCTCACTGCAGGAACTTACCTTCTTTCAGTGTAAGGGCGTGGTTCTTGTGCCCGTGGAGAATGGAGGAGGAATTCAGGAGGACAAGTCATTGCTCCAATCATTAAGAATATTCATCTGTGGCAAACTCTTATCTCGGTGGCCCATGGGCATGGGAGAATCAGAGACCATTTGCCCTTTCCCTGCTTCCCTGAGGATACTTGATGTTGAGGAAGAGCCAAGCATGAAGTCAATGGCTCTGCTCTCAAACCTCACGTCTCTCACCGGTCTAACGCTAAACGCCTGCAGTAATTTAACAGTGGACGGATTCAATCCTCTCATTGCAGTCAACCTCATACGACTGCAAGTGCGCGGTTGCAACACCTTAGCAGCAGATATGCTCTCAGAGGTGGCCTCTCAGAGGGCCAAATTATTGCCTGCAGGTTCGTTCCGATTGGAGGTTCTCAGGGTGGATGACATCTCTGGATTGCTTGTTGCTCCTATTTGCAACCTCCTCGCCCCGGCCCTCCGCATACTTGAATTCAGGTCTGATGGTAGGACGGAAAGCTTCACGGAAGAGCAAGATAAAGCGCTGCAGCTCCTCACCTCCCTTGAGAAACTACATTTTTTCATTTGCGAGGGTCTGCAGTCCCTTCCTCAAGGGTTACATCGCCTTTCTTCTCTCAAGGAGTTACATGTCAGGTACTGTCCAAATATCCGATCGATGCCCAAGGAGGGCCTCCCGGTTTCGCTGAGAAAACTATATATGAGTGATTGCAGCGCTGAGATAGACGAGCAAATTGAGAAAATCAAAAGAACCAACCCAGATTTCCTTTGA


Protein sequences

Name Description Sequence
putative RGA protein 567B-3.2 putative RGA protein 567B-3.2 [Aegilops tauschii].

ISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDHQADRNYLEELVDNGFLMKQFDWRDRWWYVMHDLMHELSKSVSAQECHNISGFDFRADAISQSVRHLSINIEDRYDANFEKEMCKLRERIDIANLRTLMICRRYEEERIAKILKDSFKEINSLRVLFIAVSTPESFPYRFSKLIHLQYLKISSSYKDGEISLPSTLSRFYHLKFLDLDDWNGRSDLPEDFSHLENLHDFRAGSELHSNIRNVGKMKHLQELKEFHVRKESMGFELSELGALSELEEELTVLGLEHVATKEEATAAKLMLKRNLKQLELLWSGRDGPTTDAGILDALQPHSNLRVLTIANHGGTVGPSWLCLDMWLTRLETLILEGISWSTLPPFGTLPNLKGLKLKKISGMHQFGKCCMRLKTVEFYEIPELAEWPVEPKCHSFPSIEEIKCIDCPNLRVMPFSEVSCTNLRRLEVSGCPKMSLPSMPYTSTLTSCDVKRCDSERLLYDGKELVVSGYGGALTFHNLDKVEDMTVGKCDGLFPQELDDSFVFHSVESLKLDVSHLTSSKSSPSKVLNCFPALSVLHIDGCEECVMQFPSSSSLQELTFFQCKGVVLVPVENGGGIQEDKSLLQSLRIFICGKLLSRWPMGMGESETICPFPASLRILDVEEEPSMKSMALLSNLTSLTGLTLNACSNLTVDGFNPLIAVNLIRLQVRGCNTLAADMLSEVASQRAKLLPAGSFRLEVLRVDDISGLLVAPICNLLAPALRILEFRSDGRTESFTEEQDKALQLLTSLEKLHFFICEGLQSLPQGLHRLSSLKELHVRYCPNIRSMPKEGLPVSLRKLYMSDCSAEIDEQIEKIKRTNPDFL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
1-481 PTHR11017:SF28

ISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDHQADRNYLEELVDNGFLMKQFDWRDRWWYVMHDLMHELSKSVSAQECHNISGFDFRADAISQSVRHLSINIEDRYDANFEKEMCKLRERIDIANLRTLMICRRYEEERIAKILKDSFKEINSLRVLFIAVSTPESFPYRFSKLIHLQYLKISSSYKDGEISLPSTLSRFYHLKFLDLDDWNGRSDLPEDFSHLENLHDFRAGSELHSNIRNVGKMKHLQELKEFHVRKESMGFELSELGALSELEEELTVLGLEHVATKEEATAAKLMLKRNLKQLELLWSGRDGPTTDAGILDALQPHSNLRVLTIANHGGTVGPSWLCLDMWLTRLETLILEGISWSTLPPFGTLPNLKGLKLKKISGMHQFGKCCMRLKTVEFYEIPELAEWPVEPKCHSFPSIEEIKCIDCPNLRVMPFSEVSCTNLRRLEVSGCPKMSLPSM

HMMPanther: PTHR11017
1-481 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ISYDCLPFDLKKCFSYCGLFPEDHWFTSSEINHFWVAVGIIDSDHQADRNYLEELVDNGFLMKQFDWRDRWWYVMHDLMHELSKSVSAQECHNISGFDFRADAISQSVRHLSINIEDRYDANFEKEMCKLRERIDIANLRTLMICRRYEEERIAKILKDSFKEINSLRVLFIAVSTPESFPYRFSKLIHLQYLKISSSYKDGEISLPSTLSRFYHLKFLDLDDWNGRSDLPEDFSHLENLHDFRAGSELHSNIRNVGKMKHLQELKEFHVRKESMGFELSELGALSELEEELTVLGLEHVATKEEATAAKLMLKRNLKQLELLWSGRDGPTTDAGILDALQPHSNLRVLTIANHGGTVGPSWLCLDMWLTRLETLILEGISWSTLPPFGTLPNLKGLKLKKISGMHQFGKCCMRLKTVEFYEIPELAEWPVEPKCHSFPSIEEIKCIDCPNLRVMPFSEVSCTNLRRLEVSGCPKMSLPSM

superfamily: SSF52058
74-495 SSF52058,LRR

VMHDLMHELSKSVSAQECHNISGFDFRADAISQSVRHLSINIEDRYDANFEKEMCKLRERIDIANLRTLMICRRYEEERIAKILKDSFKEINSLRVLFIAVSTPESFPYRFSKLIHLQYLKISSSYKDGEISLPSTLSRFYHLKFLDLDDWNGRSDLPEDFSHLENLHDFRAGSELHSNIRNVGKMKHLQELKEFHVRKESMGFELSELGALSELEEELTVLGLEHVATKEEATAAKLMLKRNLKQLELLWSGRDGPTTDAGILDALQPHSNLRVLTIANHGGTVGPSWLCLDMWLTRLETLILEGISWSTLPPFGTLPNLKGLKLKKISGMHQFGKCCMRLKTVEFYEIPELAEWPVEPKCHSFPSIEEIKCIDCPNLRVMPFSEVSCTNLRRLEVSGCPKMSLPSMPYTSTLTSCDVKRC

Gene3D: G3DSA:3.80.10.10
149-278 G3DSA:3.80.10.10

EEERIAKILKDSFKEINSLRVLFIAVSTPESFPYRFSKLIHLQYLKISSSYKDGEISLPSTLSRFYHLKFLDLDDWNGRSDLPEDFSHLENLHDFRAGSELHSNIRNVGKMKHLQELKEFHVRKESMGFE

Gene3D: G3DSA:3.80.10.10
315-498 G3DSA:3.80.10.10

RNLKQLELLWSGRDGPTTDAGILDALQPHSNLRVLTIANHGGTVGPSWLCLDMWLTRLETLILEGISWSTLPPFGTLPNLKGLKLKKISGMHQFGKCCMRLKTVEFYEIPELAEWPVEPKCHSFPSIEEIKCIDCPNLRVMPFSEVSCTNLRRLEVSGCPKMSLPSMPYTSTLTSCDVKRCDSE

Gene3D: G3DSA:3.80.10.10
546-610 G3DSA:3.80.10.10

FHSVESLKLDVSHLTSSKSSPSKVLNCFPALSVLHIDGCEECVMQFPSSSSLQELTFFQCKGVVL

superfamily: SSF52047
553-846 SSF52047,LRR

KLDVSHLTSSKSSPSKVLNCFPALSVLHIDGCEECVMQFPSSSSLQELTFFQCKGVVLVPVENGGGIQEDKSLLQSLRIFICGKLLSRWPMGMGESETICPFPASLRILDVEEEPSMKSMALLSNLTSLTGLTLNACSNLTVDGFNPLIAVNLIRLQVRGCNTLAADMLSEVASQRAKLLPAGSFRLEVLRVDDISGLLVAPICNLLAPALRILEFRSDGRTESFTEEQDKALQLLTSLEKLHFFICEGLQSLPQGLHRLSSLKELHVRYCPNIRSMPKEGLPVSLRKLYMSDC

Gene3D: G3DSA:3.80.10.10
654-713 G3DSA:3.80.10.10

FPASLRILDVEEEPSMKSMALLSNLTSLTGLTLNACSNLTVDGFNPLIAVNLIRLQVRGC

Gene3D: G3DSA:3.80.10.10
745-826 G3DSA:3.80.10.10

DDISGLLVAPICNLLAPALRILEFRSDGRTESFTEEQDKALQLLTSLEKLHFFICEGLQSLPQGLHRLSSLKELHVRYCPNI


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox