PRGDB00050712 (putative RGA protein 567A-4.7)

From PRG Wiki
Jump to: navigation, search
putative RGA protein 567A-4.7
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30023636 (AY123939)
Gene Class Unknown
Domain Type LRR
Gene Species Aegilops tauschii

Comment?

Aegilops tauschii putative RGA protein 567A-4.7 gene, partial cds.

DNA Sequence

GGCGTTTTCCCGGCAGATCATTGGTTTACTTGTTCAGAAATCAATCATTTCTGGGTTGCAGTCTGCATCATATACTCTGATCACCAAGCCGATAGGAATTACCTGGAAGAGCTAGTGGACAATGGTTTTCTCATGAAGAAGAAAGAGTATTATTTGGATGATCGATGCAAACAAAAGGAATTTGATTGCTATGTAATGCATGATTTAATGCATGAGCTATCTAAGAGTGTTTCTGCACAAGAATGCCTCAATATAAGTGGCTTTGATTTCAGAGCTGATGCCATCCCGCAATCTGTTCGACACTTATCTATCAACATAGAAGACAGATATGATGCAAATTTTGAGGAAGAAATGTCTAAACTAAGGGAGAAGATAGACATTGCTAATGTGCGGACTTTGATGATTTTTAGAGAATATGAAGAAGAAAGAACCGCCAAGATATTGAAAGATAGCTTCAAGGAAATAAATAGTCTGCGTGTCCTATTTATAGTGGTGAAGTCTGCACAATCTTTTCCGGATATGTTTTCAAAACTTATCCACCTCCAGTACCTCAAAATTAGTTCACCTCACATTGACGGGGAAATGAGGTTACCTAGTACACTATCAAGATTTTATCACTTGAAATTCCTGGACCTAGATGATTGGCGTGGTAGTTCTGATTTGCCTGAAGACTTTAGCCACCTTGAGAATTTACATGATTTCCGTGCTGAAAGTAAACTCCACTCCAATATTCGCAATGTTGGAAAGATGAAGCATCTACAGAGGCTAGAAGAATTCCATGTTAAGAAGGAGAGCATGGGATTTGAACTGTCAGAACTTGGGCCATTGACAGAGCTTGAAGGAGGACTGACTGTACGTGGTCTTGAACACGTGGCAACCAAGGAGGAAGCTACTGCAGCCAAACTGATGTTGAAAAGGAATCTGAAGCAGTTGGAATTACTCTGGGACAGAGACCTTGGTGGACCAACTACAGATGCTGATATTCTTGATGCTCTTCAACCACACTCTAATCTTAGAGTACTTGCAATTGTAAATCATGGTGGTACCGTTGGTCCTAGCTGGTTGTGTCTTGACATCTGGTTAACAAGTTTAGAGACTCTCACTCTAGCAGGCGTATGTTGGAGCACTCTCCCGCCTTTTGCGAAGCTACCAAATCTCAAGGGACTCAAACTGATGAGAATTTCTGGAATGCATCAGTTTGGGTCTCTATGTGGTGGCACTCCAGGGAAATGTTTTATGCGCTTGAAGACAGTTGAGTTTTATGAGATGCCAGAACTTGCTGAATGGGTTGTGGAATCTAATTGCCATTCCTTTCCAAGTCTTGAAGAAATCAGATGCAGAAAGTGTCCCAACCTCCGTGTGATGCCCTTCTCGGAGGTATCTTTCACCAATTTGCGCACACTTTTTGTTTCCAGGTGCCCCAAGATGTCTCTGCCCTCCATGCCTCACACCTCCACACTGACAGATCTGAATGTTGGAATAGGTGATTCAGAAGGGTTGCGTTATGATGGAAAGAAATTGATTGTTATAGGGTATGGCGGTGCTTTGGCCTCCCACAATCTGGATACAGTAGAAGATATGATTGTCGAAAGATGCGACGGTTTGTTCCCTGAAGATTTGGATGGCAGTTTTGTCTTCCGTTCAGTTAAGAATCTCACATTACATGTATCTCTTCTTACCAGCAGCAAATCATCATCGTCAAAAGTGTTAAACTGTTTCCCAGCTCTTTCTGTGTTGGTGATAGTTGGCTATGAGGAATGTGTAATGCAGTTCCCATCATCCAGCTCACTGCAGAAACTTACCTTCTCAGGCTGCCGGGGCCTGGTTCTTGTGCCTGAGGAGAAGGAGAATGGAGGAGGAATTCATGAGGACAACTCATTGCTCCAATCATTAACAATAGTGGGATGTGGCAAACTCTTCTCTCGTTGGCCCATGGGAATGGGAGAATCAGAGACCATTTGCCCTTTCCCTGCTTCCCTGAAGAAACTTGATGTTTTCCAAGAGCCAAGCATGAAGTCAATGGCTCTGCTCTCAAACCTCACGTCTTTCACCACTCTACAGCTAAACTACTGCAGTAATTTAACAGTGGATGGATTCAATCCTCTCATCGCAGTCAACCTCATAGAGCTGCAAGTGCATAGGTGCAACACCTTAGCAGCAGATATGCTCTCAGAGGCGGCCTCTCACTCTCAGAGGGCCAAATTATTGCCTGCAGGTTACATCTCTAGATTGGAGAAACTCAATGTGGATAACAACTGTGGATTGCTTGTTGCTCCTATTTGCAACCTCCTCGCCCCGGCCCTCCACACACTTGTATTCTGGATTGATGAAACGATGGAAAGCTTGACGGAAGAGCAAGAGAAAGCGCTGCAGCTCCTCACCTCCCTCCAGAATCTAACATTTTTCAGATGCAGGGGTCTACAGTCCCTTCCTCAAGGGTTGCATCGCCTTTCTTCTCTCAAGGAGTTATGTGTCCGTGGGTGTCTAAAAATCCAATCGTTGCCCAAGGAGGGCCTCCCGCTTTCGCTGAGAAGACTAAAGATGAATTGGCGCAGCGCTGAGATAAACGAGCAAATTGAGAAAATCAAAAGAAGCAACCCAGATTTATCCGTCTCGGATTACTAA


Protein sequences

Name Description Sequence
putative RGA protein 567A-4.7 putative RGA protein 567A-4.7 [Aegilops tauschii].

GVFPADHWFTCSEINHFWVAVCIIYSDHQADRNYLEELVDNGFLMKKKEYYLDDRCKQKEFDCYVMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLMRISGMHQFGSLCGGTPGKCFMRLKTVEFYEMPELAEWVVESNCHSFPSLEEIRCRKCPNLRVMPFSEVSFTNLRTLFVSRCPKMSLPSMPHTSTLTDLNVGIGDSEGLRYDGKKLIVIGYGGALASHNLDTVEDMIVERCDGLFPEDLDGSFVFRSVKNLTLHVSLLTSSKSSSSKVLNCFPALSVLVIVGYEECVMQFPSSSSLQKLTFSGCRGLVLVPEEKENGGGIHEDNSLLQSLTIVGCGKLFSRWPMGMGESETICPFPASLKKLDVFQEPSMKSMALLSNLTSFTTLQLNYCSNLTVDGFNPLIAVNLIELQVHRCNTLAADMLSEAASHSQRAKLLPAGYISRLEKLNVDNNCGLLVAPICNLLAPALHTLVFWIDETMESLTEEQEKALQLLTSLQNLTFFRCRGLQSLPQGLHRLSSLKELCVRGCLKIQSLPKEGLPLSLRRLKMNWRSAEINEQIEKIKRSNPDLSVSDY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
64-392 PTHR11017:SF28

YVMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLM

HMMPanther: PTHR11017
64-392 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YVMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLM

superfamily: SSF52058
65-492 SSF52058,LRR

VMHDLMHELSKSVSAQECLNISGFDFRADAIPQSVRHLSINIEDRYDANFEEEMSKLREKIDIANVRTLMIFREYEEERTAKILKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKESMGFELSELGPLTELEGGLTVRGLEHVATKEEATAAKLMLKRNLKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLMRISGMHQFGSLCGGTPGKCFMRLKTVEFYEMPELAEWVVESNCHSFPSLEEIRCRKCPNLRVMPFSEVSFTNLRTLFVSRCPKMSLPSMPHTSTLTDLNV

Gene3D: G3DSA:3.80.10.10
148-265 G3DSA:3.80.10.10

LKDSFKEINSLRVLFIVVKSAQSFPDMFSKLIHLQYLKISSPHIDGEMRLPSTLSRFYHLKFLDLDDWRGSSDLPEDFSHLENLHDFRAESKLHSNIRNVGKMKHLQRLEEFHVKKES

Gene3D: G3DSA:3.80.10.10
308-478 G3DSA:3.80.10.10

LKQLELLWDRDLGGPTTDADILDALQPHSNLRVLAIVNHGGTVGPSWLCLDIWLTSLETLTLAGVCWSTLPPFAKLPNLKGLKLMRISGMHQFGSLCGGTPGKCFMRLKTVEFYEMPELAEWVVESNCHSFPSLEEIRCRKCPNLRVMPFSEVSFTNLRTLFVSRCPKMSL

superfamily: SSF52047
565-835 SSF52047,LRR

SSSKVLNCFPALSVLVIVGYEECVMQFPSSSSLQKLTFSGCRGLVLVPEEKENGGGIHEDNSLLQSLTIVGCGKLFSRWPMGMGESETICPFPASLKKLDVFQEPSMKSMALLSNLTSFTTLQLNYCSNLTVDGFNPLIAVNLIELQVHRCNTLAADMLSEAASHSQRAKLLPAGYISRLEKLNVDNNCGLLVAPICNLLAPALHTLVFWIDETMESLTEEQEKALQLLTSLQNLTFFRCRGLQSLPQGLHRLSSLKELCVRGCLKIQSLP

Gene3D: G3DSA:3.80.10.10
586-606 G3DSA:3.80.10.10

ECVMQFPSSSSLQKLTFSGCR

Gene3D: G3DSA:3.80.10.10
624-836 G3DSA:3.80.10.10

DNSLLQSLTIVGCGKLFSRWPMGMGESETICPFPASLKKLDVFQEPSMKSMALLSNLTSFTTLQLNYCSNLTVDGFNPLIAVNLIELQVHRCNTLAADMLSEAASHSQRAKLLPAGYISRLEKLNVDNNCGLLVAPICNLLAPALHTLVFWIDETMESLTEEQEKALQLLTSLQNLTFFRCRGLQSLPQGLHRLSSLKELCVRGCLKIQSLPK


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox