PRGDB00050747 (R 11)

From PRG Wiki
Jump to: navigation, search
R 11
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 27764534 (AF541963)
Gene Class Unknown
Domain Type LRR
Gene Species Glycine max

Comment?

Glycine max cv Williams 82 BAC clone Gm_ISb001_091_F11, complete sequence.

DNA Sequence

ATGGCAGACAACACCCGTATGAAGGAGGTTTATGCAGAATTGAAGAAAAACGCTGATGCGATTACTCGTGTTAGTGACGATCTTCAGAACCATATTGAACGGTTGGAAGCTACAAATCACGCTCAGATGGAGAAGATTGAAGTGATGCAGTCGACGAATGATTCTCAATTCTCACAACTGAATGCAGTAATGTCACAGGTGCTGCAGCGTCTACAAAACATTCCGATGTCTTCCCATGGTGCATCGAACTCACAGAAAGAGCAGCAGAGAAGTTCGTTTCAGGTGAGATCTGTCAAACTTGATTTTCCTCGCTTTGATGGAAAAAATGTGATGGATTGGATATTCAAGGCTGAACAATTTTTCGATTACTATGCAACACCAGATGCTGATAGATTGATTATTGCTTCAGTACATTTAGATCAGGATGTTGTCCCTTGGTATCAAATGCTTCAAAAAACTGAACCATTCAGTTCATGGCAAGCATTTACTAGAGCCTTAGAACTTGATTTTGGACCATCTGCTTATGACTGTCCTCGTGCTACTTTGTTTAAACTGAATCAATCTGCAACTGTGAATGAATATTATATGCAATTCACTGCTCTAGTAAATAGAGTAGATGGATTAAGTGCAGAGGCAATTTTGGATTGCTTTGTTAGTGGGTTGCAGGAAGAAATCAGCAGGGATGTGAAAGCAATGGAACCCCGTACCTTAACCAAGGCAGTTGCATTGGCCAAATTATTTGAAGAAAAATACACTTCACCACCTAAAACAAAAACATTCTCAAACCTAGCCAGAAATTTTACCTCAAACACTTCAGCCACACAGAAATATCCACCAACTAACCAAAAAAATGACAATCCAAAACCAAATTTACCACCACTTCTACCTACACCATCAACCAAACCATTCAACCTTCGAAACCAAAACATCAAAAAAATTTCCCCTGCTGAGATTCAATTGAGAAGAGAAAAGAATCTGTGTTACTTTTGTGATGAAAAATTTTCCCCTGCACACAAGTGTCCTAATAGACAAGTTATGCTGTTACAACTGGAGGAAACAGATGAGGATCAAACTGATGAACAGGTAATGGTGACTGAAGAAGCTAACATGGATGATGATACTCATCATTTGTCCTTAAATGCTATGAGAGGATCAAATGGTGTGGGCACTATTCGATTTACTGGCCAAGTGGGAGGCATAGCAGTTAAGATATTGGTGGATGGAGGTAGCTCTGACAACTTCATTCAGCCTAGAGTGGCTCAGGTGCTTAAGTTACCAGTGGAACCAGCTCCTAATCTTCGAGTTTTAGTGGGAAATGGACAGATTCTGAGTGCAGAAGGAATTGTTCAGCAATTACCATTACATATTCAAGGCCAAGAAGTGAAAGTGCCAGTGTACTTGTTACAAATTTCTGGTGCAGATGTGATATTGGGGTCCACATGGTTAGCAACATTAGGTCCTCATGTAGCTGACTATGCAGCATTGACCTTGAAATTCTTCCAAAATGATAAATTCATTACTTTACAAGGTGAAGGTAATTCAGAAGCAACACAGGCTCAGCTCCATCATTTCAGAAGATTGCAAAACACAAAGTCAATTGAAGAGTGCTTTGCAATACAATTGATTCAGAAGGAAGTACCAGAAGACACTTTGAAGGATTTACCAACAAATATTGATCCTGAATTGGCCATCTTACTCCACACTTATGCTCAAGTGTTTGCAGTACCAGCATCACTGCCACCTCAGAGGGAACAGGATCATGCTATACCACTGAAACAAGGGTCAGGCCCCGTTAAAGTAAGACCATACAGATATCCTCACACACAAAAGGATCAGATTGAAAAGATGATACAAGAAATGTTGGTTCAAGGCATCATTCAACCAAGTAACAGTCCATTTTCCTTACCCATACTGCTTGTTAAGAAGAAAGATGGAAGTTGGAGATTCTGCACAGATTATAGAGCTTTGAATGCAATCACTGTGAAGGATAGCTTTCCAATGCCAACAGTGGATGAACTGCTAGATGAACTACATGGAGCTCAATATTTTTCAAAACTGGATTTGAGGTCAGGATACCATCAAATTCTGGTACAGCCTGAGGATAGAGAGAAAACTGCTTTTAGAACACATCATGGCCATTATGAATGGTTAGTGATGCCATTTGGTCTTACTAATGCACCAGCCACATTCCAATGCTTAATGAACAAAATATTTCAGTTTGCTCTCAGAAAATTTGTTCTTGTGTTTTTTGATGACATCTTGATATATAGTGCTTCTTGGAAGGATCATCTCAAGCACTTGGAATCTGTGCTACAGACCTTGAAGCAACATCAGTTATTTGCTAGATTGTCCAAATGTTCATTTGGAGATACAGAAGTTGATTACTTGGGCCACAAGGTATCTGGGTTAGGAGTTTCCATGGAGAATACAAAGGTACAAGCAGTATTAGATTGGCCTACTCCAAATAATGTCAAGCAGTTAAGGGGATTTCTAGGCTTAACAGGCTATTATAGAAGATTTATTAAATCTTATGCCAATATTGCTGGACCATTAACTGATCTTTTACAAAAAGACAGTTTCTTATGGAATAATGAAGCAGAAGCAGCATTTGTCAAGCTCAAAAAAGCCATGACGGAGGCTCCAGTATTATCACTACCAGATTTTTCTCAACCATTTATTCTGGAAACTGACGCATCAGGTATTGGTGTGGGAGCAGTGTTGGGACAGAATGGCCACCCAATTGCTTATTTTTCAAAAAAATTGGCACCTAGAATGCAGAAACAATCAGCTTATACCAGGGAGTTGCTAGCTATTACTGAGGCTCTATCCAAATTCAGACACTACTTATTAGGCAACAAATTCATTATCAGGACTGATCAAAGAAGTTTGAAAAGTTTGATGGATCAGTCTTTACAAACCCCTGAACAACAAGCTTGGTTACACAAATTCTTAGGGTATGATTTCAAGATTGAATATAAGCCTGGGAAAGATAATCAAGCAGCTGATGCTTTATCAAGAATGTTTATGCTAGCATGGTCAGAACCTCATTCTATCTTCTTGGAAGAATTGAGAGCTAGACTAATTAGTGATCCTCATTTGAAACAGTTGATGGAGACATACAAGCAAGGTGCTGATGCAAGTCATTATACAGTTAGGGAAGGCTTACTGTATTGGAAAGATAGAGTAGTAATACCTGCTGAGGAAGAGATTGTGAACAAAATACTCCAAGAATATCATAGCTCACCTATTGGAGGGCATGCAGGTATAACTAGAACTCTGGCAAGGCTGAAAGCTCAATTCTACTGGCCTAAGATGCAGGAAGATGTCAAAGCTTATATACAGAAATGCTTGATTTGTCAACAAGCTAAATCAAACAATACACTGCCAGCAGGACTACTCCAACCTTTACCTATTCCTCAACAAGTTTGGGAAGATGTAGCCATGGATTTCATCACAGGTTTACCAAATTCCTTTGGATTATCTGTCATAATGGTAGTCATTGATAGACTCACCAAATATGCTCATTTCATTCCATTAAAAGCTGATTATAACAGTAAGGTGGTAGCAGAGGCATTTATGAGTCACATAGTCAAATTACATGGGATACCAAGATCTATAGTGTCTGATCGAGATAGGGTTTTTACCAGTACTTTTTGGCAACATTTATTCAAGTTACAAGGTACTACATTGGCCATGTCATCAGCTTATCATCCACAGTCAGATGGACAATCTGAGGTGCTGAATAAATGTTTGGAGATGTATCTTAGATGCTTCACGTATGAACATCCTAAAGGTTGGGTAAAGGCATTACCATGGGCAGAGTTTTGGTATAACACTGCATATCATATGAGCTTAGGCATGACTCCATTCAGAGCCTTGTATGGGAGAGAGCCTCCTACACTGACCAGGCAAGCCTGTTCTATAGATGATCCTGCTGAAGTGAGGGAACAATTAACTGACAGAGATGCATTGTTAGCTAAGCTTAAAATTAATTTGACAAGAGCACAACAGGTCATGAAGAGACAAGCAGACAAGAAGAGGTTGGATGTGTCATTCCAAATAGGAGATGAGGTACTGGTGAAACTGCAGCCTTATAGACAGCATTCTGCTGTCCTGAGAAAGAATCAAAAGCTGTCCATGAGATACTTTGGACCATTTAAGGTGCTGGCCAAGATTGGTGATGTTGCTTATAAGTTGGAGTTGCCTTCTGCTGCACGAATTCATCCTGTTTTTCATGTGTCCCAGCTGAAGCCATTCAATGGGACTGCTCAAGATCCTTACCTGCCATTGCCTTTGACAGTCACAGAAATGGGACCAGTTATGCAGCCTGTGAAAATACTAGCAAGTCGAATTATCATCAGAGGGCACAATCAGATTGAGCAGATACTAGTGCAGTGGGAGAATGGCTTGCAAGATGAAGCTACTTGGGAGGATATTGAAGATATCAAGGCAAGCTATCCTACCTTCAACCTTGAGGACAAGGTTGTTTTTAAAGGGGAAGGCAATGTAACGAATGGAATGTCACGTGGGGAGAAGGTTAACAATACTGCTGAGTCATCAAGTGAGAGAGGATTGCATAACAAACTTGCTGATTTTGAGGAATTGGGACGTGGGAAGAGAGAGAAGAAACCAAGTTGGAAAATAACGGAATCCCACTAG


Protein sequences

Name Description Sequence
polyprotein polyprotein [Glycine max].

MADNTRMKEVYAELKKNADAITRVSDDLQNHIERLEATNHAQMEKIEVMQSTNDSQFSQLNAVMSQVLQRLQNIPMSSHGASNSQKEQQRSSFQVRSVKLDFPRFDGKNVMDWIFKAEQFFDYYATPDADRLIIASVHLDQDVVPWYQMLQKTEPFSSWQAFTRALELDFGPSAYDCPRATLFKLNQSATVNEYYMQFTALVNRVDGLSAEAILDCFVSGLQEEISRDVKAMEPRTLTKAVALAKLFEEKYTSPPKTKTFSNLARNFTSNTSATQKYPPTNQKNDNPKPNLPPLLPTPSTKPFNLRNQNIKKISPAEIQLRREKNLCYFCDEKFSPAHKCPNRQVMLLQLEETDEDQTDEQVMVTEEANMDDDTHHLSLNAMRGSNGVGTIRFTGQVGGIAVKILVDGGSSDNFIQPRVAQVLKLPVEPAPNLRVLVGNGQILSAEGIVQQLPLHIQGQEVKVPVYLLQISGADVILGSTWLATLGPHVADYAALTLKFFQNDKFITLQGEGNSEATQAQLHHFRRLQNTKSIEECFAIQLIQKEVPEDTLKDLPTNIDPELAILLHTYAQVFAVPASLPPQREQDHAIPLKQGSGPVKVRPYRYPHTQKDQIEKMIQEMLVQGIIQPSNSPFSLPILLVKKKDGSWRFCTDYRALNAITVKDSFPMPTVDELLDELHGAQYFSKLDLRSGYHQILVQPEDREKTAFRTHHGHYEWLVMPFGLTNAPATFQCLMNKIFQFALRKFVLVFFDDILIYSASWKDHLKHLESVLQTLKQHQLFARLSKCSFGDTEVDYLGHKVSGLGVSMENTKVQAVLDWPTPNNVKQLRGFLGLTGYYRRFIKSYANIAGPLTDLLQKDSFLWNNEAEAAFVKLKKAMTEAPVLSLPDFSQPFILETDASGIGVGAVLGQNGHPIAYFSKKLAPRMQKQSAYTRELLAITEALSKFRHYLLGNKFIIRTDQRSLKSLMDQSLQTPEQQAWLHKFLGYDFKIEYKPGKDNQAADALSRMFMLAWSEPHSIFLEELRARLISDPHLKQLMETYKQGADASHYTVREGLLYWKDRVVIPAEEEIVNKILQEYHSSPIGGHAGITRTLARLKAQFYWPKMQEDVKAYIQKCLICQQAKSNNTLPAGLLQPLPIPQQVWEDVAMDFITGLPNSFGLSVIMVVIDRLTKYAHFIPLKADYNSKVVAEAFMSHIVKLHGIPRSIVSDRDRVFTSTFWQHLFKLQGTTLAMSSAYHPQSDGQSEVLNKCLEMYLRCFTYEHPKGWVKALPWAEFWYNTAYHMSLGMTPFRALYGREPPTLTRQACSIDDPAEVREQLTDRDALLAKLKINLTRAQQVMKRQADKKRLDVSFQIGDEVLVKLQPYRQHSAVLRKNQKLSMRYFGPFKVLAKIGDVAYKLELPSAARIHPVFHVSQLKPFNGTAQDPYLPLPLTVTEMGPVMQPVKILASRIIIRGHNQIEQILVQWENGLQDEATWEDIEDIKASYPTFNLEDKVVFKGEGNVTNGMSRGEKVNNTAESSSERGLHNKLADFEELGRGKREKKPSWKITESH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10178:SF14
75-1452 PTHR10178:SF14,RETROVIRUS POLYPROTEIN

PMSSHGASNSQKEQQRSSFQVRSVKLDFPRFDGKNVMDWIFKAEQFFDYYATPDADRLIIASVHLDQDVVPWYQMLQKTEPFSSWQAFTRALELDFGPSAYDCPRATLFKLNQSATVNEYYMQFTALVNRVDGLSAEAILDCFVSGLQEEISRDVKAMEPRTLTKAVALAKLFEEKYTSPPKTKTFSNLARNFTSNTSATQKYPPTNQKNDNPKPNLPPLLPTPSTKPFNLRNQNIKKISPAEIQLRREKNLCYFCDEKFSPAHKCPNRQVMLLQLEETDEDQTDEQVMVTEEANMDDDTHHLSLNAMRGSNGVGTIRFTGQVGGIAVKILVDGGSSDNFIQPRVAQVLKLPVEPAPNLRVLVGNGQILSAEGIVQQLPLHIQGQEVKVPVYLLQISGADVILGSTWLATLGPHVADYAALTLKFFQNDKFITLQGEGNSEATQAQLHHFRRLQNTKSIEECFAIQLIQKEVPEDTLKDLPTNIDPELAILLHTYAQVFAVPASLPPQREQDHAIPLKQGSGPVKVRPYRYPHTQKDQIEKMIQEMLVQGIIQPSNSPFSLPILLVKKKDGSWRFCTDYRALNAITVKDSFPMPTVDELLDELHGAQYFSKLDLRSGYHQILVQPEDREKTAFRTHHGHYEWLVMPFGLTNAPATFQCLMNKIFQFALRKFVLVFFDDILIYSASWKDHLKHLESVLQTLKQHQLFARLSKCSFGDTEVDYLGHKVSGLGVSMENTKVQAVLDWPTPNNVKQLRGFLGLTGYYRRFIKSYANIAGPLTDLLQKDSFLWNNEAEAAFVKLKKAMTEAPVLSLPDFSQPFILETDASGIGVGAVLGQNGHPIAYFSKKLAPRMQKQSAYTRELLAITEALSKFRHYLLGNKFIIRTDQRSLKSLMDQSLQTPEQQAWLHKFLGYDFKIEYKPGKDNQAADALSRMFMLAWSEPHSIFLEELRARLISDPHLKQLMETYKQGADASHYTVREGLLYWKDRVVIPAEEEIVNKILQEYHSSPIGGHAGITRTLARLKAQFYWPKMQEDVKAYIQKCLICQQAKSNNTLPAGLLQPLPIPQQVWEDVAMDFITGLPNSFGLSVIMVVIDRLTKYAHFIPLKADYNSKVVAEAFMSHIVKLHGIPRSIVSDRDRVFTSTFWQHLFKLQGTTLAMSSAYHPQSDGQSEVLNKCLEMYLRCFTYEHPKGWVKALPWAEFWYNTAYHMSLGMTPFRALYGREPPTLTRQACSIDDPAEVREQLTDRDALLAKLKINLTRAQQVMKRQADKKRLDVSFQIGDEVLVKLQPYRQHSAVLRKNQKLSMRYFGPFKVLAKIGDVAYKLELPSAARIHPVFHVSQLKPFNGTAQDPYLPLPLTVTEMGPVMQPVKILASRII

HMMPanther: PTHR10178
75-1452 PTHR10178,GAG/POL/ENV POLYPROTEIN

PMSSHGASNSQKEQQRSSFQVRSVKLDFPRFDGKNVMDWIFKAEQFFDYYATPDADRLIIASVHLDQDVVPWYQMLQKTEPFSSWQAFTRALELDFGPSAYDCPRATLFKLNQSATVNEYYMQFTALVNRVDGLSAEAILDCFVSGLQEEISRDVKAMEPRTLTKAVALAKLFEEKYTSPPKTKTFSNLARNFTSNTSATQKYPPTNQKNDNPKPNLPPLLPTPSTKPFNLRNQNIKKISPAEIQLRREKNLCYFCDEKFSPAHKCPNRQVMLLQLEETDEDQTDEQVMVTEEANMDDDTHHLSLNAMRGSNGVGTIRFTGQVGGIAVKILVDGGSSDNFIQPRVAQVLKLPVEPAPNLRVLVGNGQILSAEGIVQQLPLHIQGQEVKVPVYLLQISGADVILGSTWLATLGPHVADYAALTLKFFQNDKFITLQGEGNSEATQAQLHHFRRLQNTKSIEECFAIQLIQKEVPEDTLKDLPTNIDPELAILLHTYAQVFAVPASLPPQREQDHAIPLKQGSGPVKVRPYRYPHTQKDQIEKMIQEMLVQGIIQPSNSPFSLPILLVKKKDGSWRFCTDYRALNAITVKDSFPMPTVDELLDELHGAQYFSKLDLRSGYHQILVQPEDREKTAFRTHHGHYEWLVMPFGLTNAPATFQCLMNKIFQFALRKFVLVFFDDILIYSASWKDHLKHLESVLQTLKQHQLFARLSKCSFGDTEVDYLGHKVSGLGVSMENTKVQAVLDWPTPNNVKQLRGFLGLTGYYRRFIKSYANIAGPLTDLLQKDSFLWNNEAEAAFVKLKKAMTEAPVLSLPDFSQPFILETDASGIGVGAVLGQNGHPIAYFSKKLAPRMQKQSAYTRELLAITEALSKFRHYLLGNKFIIRTDQRSLKSLMDQSLQTPEQQAWLHKFLGYDFKIEYKPGKDNQAADALSRMFMLAWSEPHSIFLEELRARLISDPHLKQLMETYKQGADASHYTVREGLLYWKDRVVIPAEEEIVNKILQEYHSSPIGGHAGITRTLARLKAQFYWPKMQEDVKAYIQKCLICQQAKSNNTLPAGLLQPLPIPQQVWEDVAMDFITGLPNSFGLSVIMVVIDRLTKYAHFIPLKADYNSKVVAEAFMSHIVKLHGIPRSIVSDRDRVFTSTFWQHLFKLQGTTLAMSSAYHPQSDGQSEVLNKCLEMYLRCFTYEHPKGWVKALPWAEFWYNTAYHMSLGMTPFRALYGREPPTLTRQACSIDDPAEVREQLTDRDALLAKLKINLTRAQQVMKRQADKKRLDVSFQIGDEVLVKLQPYRQHSAVLRKNQKLSMRYFGPFKVLAKIGDVAYKLELPSAARIHPVFHVSQLKPFNGTAQDPYLPLPLTVTEMGPVMQPVKILASRII

HMMPfam: PF03732
IPR005162
134-223 Retrotrans_gag
Retrotransposon gag protein

IASVHLDQDVVPWYQMLQKTEPFSSWQAFTRALELDFGPSAYDCPRATLFKLNQSATVNEYYMQFTALVNRVDGLSAEAILDCFVSGLQE

superfamily: SSF50630
IPR021109
383-491 Pept_Aspartic
Peptidase aspartic

RGSNGVGTIRFTGQVGGIAVKILVDGGSSDNFIQPRVAQVLKLPVEPAPNLRVLVGNGQILSAEGIVQQLPLHIQGQEVKVPVYLLQISGADVILGSTWLATLGPHVAD

HMMPfam: PF13650
395-481 Asp_protease_2,Aspartyl protease

GQVGGIAVKILVDGGSSDNFIQPRVAQVLKLPVEPAPNLRVLVGNGQILSAEGIVQQLPLHIQGQEVKVPVYLLQISGADVILGSTW

superfamily: SSF56672
564-993 SSF56672

ILLHTYAQVFAVPASLPPQREQDHAIPLKQGSGPVKVRPYRYPHTQKDQIEKMIQEMLVQGIIQPSNSPFSLPILLVKKKDGSWRFCTDYRALNAITVKDSFPMPTVDELLDELHGAQYFSKLDLRSGYHQILVQPEDREKTAFRTHHGHYEWLVMPFGLTNAPATFQCLMNKIFQFALRKFVLVFFDDILIYSASWKDHLKHLESVLQTLKQHQLFARLSKCSFGDTEVDYLGHKVSGLGVSMENTKVQAVLDWPTPNNVKQLRGFLGLTGYYRRFIKSYANIAGPLTDLLQKDSFLWNNEAEAAFVKLKKAMTEAPVLSLPDFSQPFILETDASGIGVGAVLGQNGHPIAYFSKKLAPRMQKQSAYTRELLAITEALSKFRHYLLGNKFIIRTDQRSLKSLMDQSLQTPEQQAWLHKFLGYDFKIEYK

Gene3D: G3DSA:3.10.10.10
587-725 G3DSA:3.10.10.10

HAIPLKQGSGPVKVRPYRYPHTQKDQIEKMIQEMLVQGIIQPSNSPFSLPILLVKKKDGSWRFCTDYRALNAITVKDSFPMPTVDELLDELHGAQYFSKLDLRSGYHQILVQPEDREKTAFRTHHGHYEWLVMPFGLTN

ProfileScan: PS50878
IPR000477
621-800 RT_POL
Reverse transcriptase

LVQGIIQPSNSPFSLPILLVKKKDGSWRFCTDYRALNAITVKDSFPMPTVDELLDELHGAQYFSKLDLRSGYHQILVQPEDREKTAFRTHHGHYEWLVMPFGLTNAPATFQCLMNKIFQFALRKFVLVFFDDILIYSASWKDHLKHLESVLQTLKQHQLFARLSKCSFGDTEVDYLGHKV

HMMPfam: PF00078
IPR000477
640-799 RVT_1
Reverse transcriptase

VKKKDGSWRFCTDYRALNAITVKDSFPMPTVDELLDELHGAQYFSKLDLRSGYHQILVQPEDREKTAFRTHHGHYEWLVMPFGLTNAPATFQCLMNKIFQFALRKFVLVFFDDILIYSASWKDHLKHLESVLQTLKQHQLFARLSKCSFGDTEVDYLGHK

Gene3D: G3DSA:3.30.420.10
901-1010 G3DSA:3.30.420.10

IGVGAVLGQNGHPIAYFSKKLAPRMQKQSAYTRELLAITEALSKFRHYLLGNKFIIRTDQRSLKSLMDQSLQTPEQQAWLHKFLGYDFKIEYKPGKDNQAADALSRMFML

ProfileScan: PS50994
IPR001584
1133-1297 INTEGRASE
Integrase, catalytic core

LQPLPIPQQVWEDVAMDFITGLPNSFGLSVIMVVIDRLTKYAHFIPLKADYNSKVVAEAFMSHIVKLHGIPRSIVSDRDRVFTSTFWQHLFKLQGTTLAMSSAYHPQSDGQSEVLNKCLEMYLRCFTYEHPKGWVKALPWAEFWYNTAYHMSLGMTPFRALYGRE

superfamily: SSF53098
IPR012337
1135-1297 RNaseH_fold
Ribonuclease H-like domain

PLPIPQQVWEDVAMDFITGLPNSFGLSVIMVVIDRLTKYAHFIPLKADYNSKVVAEAFMSHIVKLHGIPRSIVSDRDRVFTSTFWQHLFKLQGTTLAMSSAYHPQSDGQSEVLNKCLEMYLRCFTYEHPKGWVKALPWAEFWYNTAYHMSLGMTPFRALYGRE

Gene3D: G3DSA:3.30.420.10
1136-1290 G3DSA:3.30.420.10

LPIPQQVWEDVAMDFITGLPNSFGLSVIMVVIDRLTKYAHFIPLKADYNSKVVAEAFMSHIVKLHGIPRSIVSDRDRVFTSTFWQHLFKLQGTTLAMSSAYHPQSDGQSEVLNKCLEMYLRCFTYEHPKGWVKALPWAEFWYNTAYHMSLGMTPF

HMMPfam: PF00665
IPR001584
1140-1252 rve
Integrase, catalytic core

QQVWEDVAMDFITGLPNSFGLSVIMVVIDRLTKYAHFIPLKADYNSKVVAEAFMSHIVKLHGIPRSIVSDRDRVFTSTFWQHLFKLQGTTLAMSSAYHPQSDGQSEVLNKCLE

superfamily: SSF54160
IPR016197
1404-1484 Chromodomain-like
Chromo domain-like

AARIHPVFHVSQLKPFNGTAQDPYLPLPLTVTEMGPVMQPVKILASRIIIRGHNQIEQILVQWENGLQDEATWEDIEDIKA

HMMPfam: PF00385
IPR023780
1442-1488 Chromo
Chromo domain

QPVKILASRIIIRGHNQIEQILVQWENGLQDEATWEDIEDIKASYPT


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox