PRGDB00050750 (R 11)

From PRG Wiki
Jump to: navigation, search
R 11
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 27764534 (AF541963)
Gene Class TNL
Domain Type LRR, NBS, LRR, TIR, Others
Gene Species Glycine max

Comment?

Glycine max cv Williams 82 BAC clone Gm_ISb001_091_F11, complete sequence.

DNA Sequence

ATGGCTGCGGCAACACGTTCTCGTGCATCAATCTACGATGTTTTCCTCAGCTTCAGAGGGGAAGACACACGCTATGGTTTTACTGGCAATCTCTACAAGGCTCTTTGTGACAAGGGAATTCATACCTTCTTTGACGAAGACAAGCTTCACAGTGGAGAGGAAATAACACCAGCACTTTTGAAGGCAATTCAAGATTCCAGGATTGCCATCACTGTGCTCTCTGAAGACTTTGCTTCTTCCTCATTTTGCTTGGATGAACTTGCAACCATCCTTTTCTGCGCCCAGTATAATGGGATGATGGTTATACCGGTCTTTTATAAGGTCTATCCTTGTGATGTCAGACACCAGAAAGGTACTTATGGAGAAGCATTGGCTAAGCATAAGAAAAGATTTCCAGACAAGTTGCAGAAATGGGAGAGGGCTCTGCGTCAAGTAGCCAACTTGTCTGGCCTTCATTTCAAAGATAGAGATGAATATGAATACAAGTTTATTGGGAGAATTGTTGCATCGGTCTCTGAGAAGATTAACCCTGCTAGTTTACATGTTGCGGATCTGCCTGTTGGACTAGAGTCAAAAGTACAAGAAGTAAGGAAGCTTTTGGATGTTGGAAACCATGATGGTGTCTGCATGATAGGGATCCACGGAATGGGTGGGATAGGAAAATCAACTCTTGCTCGAGCTGTCTATAATGATTTAATAATTACTGAGAATTTTGATGGTTTGTGTTTTCTTGAAAACGTGAGAGAAAGTTCAAACAATCATGGGTTACAACACCTCCAAAGCATTCTTCTTTCAGAAATACTTGGAGAGGACATCAAAGTAAGAAGTAAGCAACAAGGAATTTCAAAGATCCAGTCTATGCTTAAGGGGAAGAAGGTTCTCTTGATTCTGGACGATGTTGACAAGCCCCAGCAATTACAGACAATTGCTGGACGACGTGATTGGTTTGGTCCTGGCAGCATAATCATCATCACCACTCGGGACAAACAACTGCTAGCACCTCATGGGGTTAAAAAAAGATATGAGGTGGAGGTTTTGAATCAGAATGCTGCTCTACAATTGCTTACATGGAATGCTTTCAAAAGAGAAAAAATTGATCCAAGTTATGAGGACGTTTTGAATCGTGTAGTAACTTATGCTTCTGGCCTTCCATTGGCTTTGGAAGTCATAGGTTCCAACATGTTTGGAAAAAGGGTAGCAGAATGGAAATCTGCTGTGGAACATTATAAAAGAATTCCCAATGATGAAATCCTAGAAATTCTAAAAGTAAGCTTTGATGCTTTGGGGGAAGAACAAAAGAATGTTTTCCTTGACATTGCTTGTTGCTTCAAAGGATGCAAATTGACAGAGGTTGAACATATGCTACGTGGTCTTTACAATAACTGCATGAAACATCATATTGATGTGTTGGTTGACAAATCTCTCATAAAGGTTAGGCATGGTACAGTAAATATGCATGACCTAATTCAGGTTGTGGGTAGAGAAATTGAGCGGCAGATATCACCTGAAGAGCCAGGGAAGTGCAAGAGATTATGGTTACCAAAAGATATAATTCAAGTTTTAAAACACAACACGGGAACTAGTAAGATTGAAATCATATGTCTGGATTTCTCCATATCTGACAAAGAACAGACAGTGGAATGGAACCAAAACGCCTTCATGAAGATGGAAAACCTTAAAATCCTTATTATTAGAAATGGCAAATTTTCCAAAGGTCCCAATTATTTTCCAGAAGGTTTGAGAGTACTGGAATGGCACAGATATCCTTCAAAGTGTTTACCATCTAACTTTCATCCGAACAACCTTCTTATATGCAAGTTACCTGACAGTTCCATGGCGTCATTTGAGTTTCATGGCTCATCGAAGTTCGGGCATCTAACAGTTTTGAAGTTTGACAACTGCAAATTTTTAACACAGATACCTGATGTATCTGATCTCCCAAATTTGAGGGAACTTTCATTTAAAGGGTGTGAGAGTTTAGTTGCAGTTGATGACTCAATTGGTTTTCTGAATAAACTTAAAAAATTGAATGCTTATGGTTGCAGGAAGCTTACAAGTTTTCCTCCTCTCAACTTGACCTCTCTTGAAACACTTCAACTTTCTGGGTGTTCCAGTCTTGAGTATTTTCCAGAAATATTAGGAGAGATGGAAAACATAAAGCAACTTGTTTTGAGAGACCTTCCCATAAAAGAATTGCCATTTTCATTTCAAAATCTTATTGGACTTCAAGTGTTATACCTGTGGAGCTGTTTAATTGTTGAGTTACCATGCAGATTAGTGATGATGCCCGAATTGTTTCAACTCCATATTGAATATTGCAACAGGTGGCAATGGGTAGAATCGGAAGAAGGTGAAGAAAAAGTGGGCTCAATACTATCTTCAAAGGCACGTTGGTTTCGTGCCATGAATTGCAATCTATGTGATGATTTTTTTTTAACAGGTTCCAAGAGGTTTACTCATGTAGAATATTTAGATCTATCGGGGAATAATTTCACAATCCTTCCCGAATTCTTCAAAGAACTGAAATTTTTAAGAACTCTTGATGTGAGTGATTGCGAGCATCTTCAGAAAATTAGAGGGCTTCCACCAAACTTAAAAGATTTCAGGGCAATAAACTGTGCATCCTTGACTTCCTCGAGTAAAAGCATGCTTCTAAATCAGGTATTGTCTTTTTATAATGTATATGATTTGATGATGGTGCACTTAATGTTGTTAAGCTTATGA


Protein sequences

Name Description Sequence
R 5 protein R 5 protein [Glycine max].

MAAATRSRASIYDVFLSFRGEDTRYGFTGNLYKALCDKGIHTFFDEDKLHSGEEITPALLKAIQDSRIAITVLSEDFASSSFCLDELATILFCAQYNGMMVIPVFYKVYPCDVRHQKGTYGEALAKHKKRFPDKLQKWERALRQVANLSGLHFKDRDEYEYKFIGRIVASVSEKINPASLHVADLPVGLESKVQEVRKLLDVGNHDGVCMIGIHGMGGIGKSTLARAVYNDLIITENFDGLCFLENVRESSNNHGLQHLQSILLSEILGEDIKVRSKQQGISKIQSMLKGKKVLLILDDVDKPQQLQTIAGRRDWFGPGSIIIITTRDKQLLAPHGVKKRYEVEVLNQNAALQLLTWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNMFGKRVAEWKSAVEHYKRIPNDEILEILKVSFDALGEEQKNVFLDIACCFKGCKLTEVEHMLRGLYNNCMKHHIDVLVDKSLIKVRHGTVNMHDLIQVVGREIERQISPEEPGKCKRLWLPKDIIQVLKHNTGTSKIEIICLDFSISDKEQTVEWNQNAFMKMENLKILIIRNGKFSKGPNYFPEGLRVLEWHRYPSKCLPSNFHPNNLLICKLPDSSMASFEFHGSSKFGHLTVLKFDNCKFLTQIPDVSDLPNLRELSFKGCESLVAVDDSIGFLNKLKKLNAYGCRKLTSFPPLNLTSLETLQLSGCSSLEYFPEILGEMENIKQLVLRDLPIKELPFSFQNLIGLQVLYLWSCLIVELPCRLVMMPELFQLHIEYCNRWQWVESEEGEEKVGSILSSKARWFRAMNCNLCDDFFLTGSKRFTHVEYLDLSGNNFTILPEFFKELKFLRTLDVSDCEHLQKIRGLPPNLKDFRAINCASLTSSSKSMLLNQVLSFYNVYDLMMVHLMLLSL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MAAATRSRASIYDVFLSFRGEDTRYGFTGNLYKALCDKGIHTFFDEDKLHSGEEITPALLKAIQDSRIAITVLSEDFASSSFCLDELATILFCAQYNGMMVIPVFYKVYPCDVRHQKGTYGEALAKHKKRFPDKLQKWERALRQVANLSGL

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SIYDVFLSFRGEDTRYGFTGNLYKALCDKGIHTFFDEDKLHSGEEITPALLKAIQDSRIAITVLSEDFASSSFCLDELATILFCAQYNGMMVIPVFYKVYPCDVRHQKGTYGEALAKHKKRFPDKLQKWERALRQVANL

Gene3D: G3DSA:3.40.50.10140
10-146 G3DSA:3.40.50.10140

SIYDVFLSFRGEDTRYGFTGNLYKALCDKGIHTFFDEDKLHSGEEITPALLKAIQDSRIAITVLSEDFASSSFCLDELATILFCAQYNGMMVIPVFYKVYPCDVRHQKGTYGEALAKHKKRFPDKLQKWERALRQVA

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

IYDVFLSFRGEDTRYGFTGNLYKALCDKGIHTFFDEDKLHSGEEITPALLKAIQDSRIAITVLSEDFASSSFCLDELATILFCAQYNGMMVIPVFYKVYPCDVRHQKGTYGEALAKHKKRFPDKLQKWERALRQVANL

HMMPfam: PF01582
IPR000157
14-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRYGFTGNLYKALCDKGIHTFFDEDKLHSGEEITPALLKAIQDSRIAITVLSEDFASSSFCLDELATILFCAQYNGMMVIPVFYKVYPCDVRHQKGTYGEALAKHKKRFPDKLQKWERALR

HMMPanther: PTHR11017:SF20
36-905 PTHR11017:SF20,SUBFAMILY NOT NAMED

CDKGIHTFFDEDKLHSGEEITPALLKAIQDSRIAITVLSEDFASSSFCLDELATILFCAQYNGMMVIPVFYKVYPCDVRHQKGTYGEALAKHKKRFPDKLQKWERALRQVANLSGLHFKDRDEYEYKFIGRIVASVSEKINPASLHVADLPVGLESKVQEVRKLLDVGNHDGVCMIGIHGMGGIGKSTLARAVYNDLIITENFDGLCFLENVRESSNNHGLQHLQSILLSEILGEDIKVRSKQQGISKIQSMLKGKKVLLILDDVDKPQQLQTIAGRRDWFGPGSIIIITTRDKQLLAPHGVKKRYEVEVLNQNAALQLLTWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNMFGKRVAEWKSAVEHYKRIPNDEILEILKVSFDALGEEQKNVFLDIACCFKGCKLTEVEHMLRGLYNNCMKHHIDVLVDKSLIKVRHGTVNMHDLIQVVGREIERQISPEEPGKCKRLWLPKDIIQVLKHNTGTSKIEIICLDFSISDKEQTVEWNQNAFMKMENLKILIIRNGKFSKGPNYFPEGLRVLEWHRYPSKCLPSNFHPNNLLICKLPDSSMASFEFHGSSKFGHLTVLKFDNCKFLTQIPDVSDLPNLRELSFKGCESLVAVDDSIGFLNKLKKLNAYGCRKLTSFPPLNLTSLETLQLSGCSSLEYFPEILGEMENIKQLVLRDLPIKELPFSFQNLIGLQVLYLWSCLIVELPCRLVMMPELFQLHIEYCNRWQWVESEEGEEKVGSILSSKARWFRAMNCNLCDDFFLTGSKRFTHVEYLDLSGNNFTILPEFFKELKFLRTLDVSDCEHLQKIRGLPPNLKDFRAINCASLTSSSKSMLLNQVLSFYNVYDLMMVHLMLL

HMMPanther: PTHR11017
36-905 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CDKGIHTFFDEDKLHSGEEITPALLKAIQDSRIAITVLSEDFASSSFCLDELATILFCAQYNGMMVIPVFYKVYPCDVRHQKGTYGEALAKHKKRFPDKLQKWERALRQVANLSGLHFKDRDEYEYKFIGRIVASVSEKINPASLHVADLPVGLESKVQEVRKLLDVGNHDGVCMIGIHGMGGIGKSTLARAVYNDLIITENFDGLCFLENVRESSNNHGLQHLQSILLSEILGEDIKVRSKQQGISKIQSMLKGKKVLLILDDVDKPQQLQTIAGRRDWFGPGSIIIITTRDKQLLAPHGVKKRYEVEVLNQNAALQLLTWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNMFGKRVAEWKSAVEHYKRIPNDEILEILKVSFDALGEEQKNVFLDIACCFKGCKLTEVEHMLRGLYNNCMKHHIDVLVDKSLIKVRHGTVNMHDLIQVVGREIERQISPEEPGKCKRLWLPKDIIQVLKHNTGTSKIEIICLDFSISDKEQTVEWNQNAFMKMENLKILIIRNGKFSKGPNYFPEGLRVLEWHRYPSKCLPSNFHPNNLLICKLPDSSMASFEFHGSSKFGHLTVLKFDNCKFLTQIPDVSDLPNLRELSFKGCESLVAVDDSIGFLNKLKKLNAYGCRKLTSFPPLNLTSLETLQLSGCSSLEYFPEILGEMENIKQLVLRDLPIKELPFSFQNLIGLQVLYLWSCLIVELPCRLVMMPELFQLHIEYCNRWQWVESEEGEEKVGSILSSKARWFRAMNCNLCDDFFLTGSKRFTHVEYLDLSGNNFTILPEFFKELKFLRTLDVSDCEHLQKIRGLPPNLKDFRAINCASLTSSSKSMLLNQVLSFYNVYDLMMVHLMLL

superfamily: SSF52540
169-417 SSF52540

ASVSEKINPASLHVADLPVGLESKVQEVRKLLDVGNHDGVCMIGIHGMGGIGKSTLARAVYNDLIITENFDGLCFLENVRESSNNHGLQHLQSILLSEILGEDIKVRSKQQGISKIQSMLKGKKVLLILDDVDKPQQLQTIAGRRDWFGPGSIIIITTRDKQLLAPHGVKKRYEVEVLNQNAALQLLTWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNMFGKRVAEWKSAVEHYKRIPNDEI

Gene3D: G3DSA:3.40.50.300
187-332 G3DSA:3.40.50.300

VGLESKVQEVRKLLDVGNHDGVCMIGIHGMGGIGKSTLARAVYNDLIITENFDGLCFLENVRESSNNHGLQHLQSILLSEILGEDIKVRSKQQGISKIQSMLKGKKVLLILDDVDKPQQLQTIAGRRDWFGPGSIIIITTRDKQLL

HMMPfam: PF00931
IPR002182
190-454 NB-ARC,NBS
NB-ARC

ESKVQEVRKLLDVGNHDGVCMIGIHGMGGIGKSTLARAVYNDLIITENFDGLCFLENVRESSNNHGLQHLQSILLSEILGEDIKVRSKQQGISKIQSMLKGKKVLLILDDVDKPQQLQTIAGRRDWFGPGSIIIITTRDKQLLAPHGVKKRYEVEVLNQNAALQLLTWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNMFGKRVAEWKSAVEHYKRIPNDEILEILKVSFDALGEEQKNVFLDIACCFKGCKLTEVEHM

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

MIGIHGMGGIGKSTLA

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

MLKGKKVLLILDDVD

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

ASGLPLALEVIGSNM

superfamily: SSF46785
415-522 SSF46785

DEILEILKVSFDALGEEQKNVFLDIACCFKGCKLTEVEHMLRGLYNNCMKHHIDVLVDKSLIKVRHGTVNMHDLIQVVGREIERQISPEEPGKCKRLWLPKDIIQVLK

superfamily: SSF52058
496-896 SSF52058,LRR

IERQISPEEPGKCKRLWLPKDIIQVLKHNTGTSKIEIICLDFSISDKEQTVEWNQNAFMKMENLKILIIRNGKFSKGPNYFPEGLRVLEWHRYPSKCLPSNFHPNNLLICKLPDSSMASFEFHGSSKFGHLTVLKFDNCKFLTQIPDVSDLPNLRELSFKGCESLVAVDDSIGFLNKLKKLNAYGCRKLTSFPPLNLTSLETLQLSGCSSLEYFPEILGEMENIKQLVLRDLPIKELPFSFQNLIGLQVLYLWSCLIVELPCRLVMMPELFQLHIEYCNRWQWVESEEGEEKVGSILSSKARWFRAMNCNLCDDFFLTGSKRFTHVEYLDLSGNNFTILPEFFKELKFLRTLDVSDCEHLQKIRGLPPNLKDFRAINCASLTSSSKSMLLNQVLSFYNVYD

Gene3D: G3DSA:3.80.10.10
543-774 G3DSA:3.80.10.10

EQTVEWNQNAFMKMENLKILIIRNGKFSKGPNYFPEGLRVLEWHRYPSKCLPSNFHPNNLLICKLPDSSMASFEFHGSSKFGHLTVLKFDNCKFLTQIPDVSDLPNLRELSFKGCESLVAVDDSIGFLNKLKKLNAYGCRKLTSFPPLNLTSLETLQLSGCSSLEYFPEILGEMENIKQLVLRDLPIKELPFSFQNLIGLQVLYLWSCLIVELPCRLVMMPELFQLHIEYCN

HMMPfam: PF13504
624-641 LRR_7,Leucine rich repeat

GHLTVLKFDNCKFLTQIP

FPrintScan: PR00364
IPR000767
690-706 DISEASERSIST
Disease resistance protein

LNLTSLETLQLSGCSSL

HMMPfam: PF13504
693-710 LRR_7,Leucine rich repeat

TSLETLQLSGCSSLEYFP

Gene3D: G3DSA:3.80.10.10
818-869 G3DSA:3.80.10.10

FTHVEYLDLSGNNFTILPEFFKELKFLRTLDVSDCEHLQKIRGLPPNLKDFR

HMMPfam: PF00560
IPR001611
821-840 LRR_1
Leucine-rich repeat

VEYLDLSGNNFTILPEFFKE


List of References

Michelle A Graham, Laura Fredrick Marek, Randy C Shoemaker
Organization, expression and evolution of a disease resistance gene cluster in soybean.
Genetics: 2002, 162(4);1961-77
PubMed:12524363 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox