PRGDB00050751 (R 11)

From PRG Wiki
Jump to: navigation, search
R 11
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 27764534 (AF541963)
Gene Class TNL
Domain Type LRR, NBS, LRR, TIR, Others
Gene Species Glycine max

Comment?

Glycine max cv Williams 82 BAC clone Gm_ISb001_091_F11, complete sequence.

DNA Sequence

ATGGCTGCAACAACACGTTCCCGTGCATCCATCTACGATGTGTTCCTAAACTTCAGAGGGGGAGACACACGCTATGGTTTCACTGGCAATCTGTACAGGGCTCTTTGTGACAAGGGAATTCATACCTTCTTTGACGAAAAGAAGCTTCACAGAGGAGAGGAAATAACACCTGCACTTTTGAAGGCAATTCAAGAGTCCAGGATTGCTATTACTGTGCTTTCTAAAAACTATGCTTCTTCCTCATTTTGTTTAGATGAACTTGTAACCATCCTTCACTGCAAGAGTGAAGGGCTGTTGGTTATACCGGTCTTTTACAACGTAGATCCTTCTGATGTCAGACACCAGAAAGGTAGTTATGGAGTAGAAATGGCTAAGCATCAGAAGAGGTTCAAAGCTAAGAAGGAGAAGCTGCAGAAATGGAGGATCGCTTTGAAACAAGTAGCTGACTTGTGTGGATATCATTTCAAAGATGGAGATGCATATGAATACAAGTTTATCCAGAGTATTGTTGAGCAGGTTTCTAGGGAGATTAATCGTGCTCCTTTACATGTTGCGGATTATCCAGTTGGTCTAGGGTCACAAGTGATAGAGGTAAGGAAGCTTTTGGATGTTGGATCCCATGATGTTGTCCACATTATAGGGATCCATGGAATGGGCGGGTTAGGAAAAACAACACTTGCTCTGGCAGTTTATAATTTGATTGCTCTCCATTTTGATGAATCCTGTTTTCTTCAAAATGTGAGAGAAGAATCAAATAAACATGGGTTAAAACACCTTCAAAGCATCCTTCTTTCAAAATTACTTGGGGAGAAGGACATCACCTTAACAAGTTGGCAAGAAGGAGCTTCAATGATACAACATAGGCTCCAACGAAAGAAGGTTCTCTTGATTTTAGACGATGTTGATAAGCGCGAGCAATTAAAGGCTATTGTTGGAAGACCTGATTGGTTTGGTCCCGGTAGCAGAGTCATCATTACCACTCGGGACAAACATCTGCTAAAATATCATGAGGTTGAAAGAACCTATGAGGTGAAGGTTTTAAATCAGAGTGCTGCTCTTCAATTGCTTAAGTGGAATGCTTTTAAAAGAGAAAAAATTGATCCAAGTTATGAGGACGTCTTGAATCGTGTAGTAACTTATGCTTCTGGCCTTCCATTGGCTTTGGAAGTCATAGGTTCCAACTTGTTTGGAAAGACTGTAGCAGAATGGGAATCTGCTATGGAACATTATAAAAGAATTCCCAGTGATGAAATCCTAGAGATTCTGAAAGTAAGCTTTGATGCTTTGGGGGAAGAACAAAAGAATGTTTTTCTTGACATTGCTTGTTGCTTCAGAGGGTATAAATGGACAGAGGTTGATGATATACTCCGTGCTCTTTATGGTAACTGCAAGAAGCATCATATTGGGGTGTTGGTTGAAAAATCTCTCATAAAGCTTAACTGTTATGGTACTGATACTGTTGAAATGCACGACTTGATTCAGGACATGGCTAGAGAAATTGAGCGGAAGAGATCACCACAAGAGCCAGGGAAGTGCAAGAGATTATGGTTACCAAAAGATATAATTCAAGTTTTTAAAGACAACACCGGAACTAGTAAAATTGAAATCATATGCCTGGATTCCTCCATATCTGACAAAGAAGAAACAGTGGAATGGAATGAAAACGCCTTCATGAAGATGGAAAACCTTAAAATACTTATTATTAGAAATGACAAATTTTCCAAAGGTCCCAATTATTTTCCAGAAGGTTTGAGAGTACTGGAATGGCACAGATATCCTTCAAATTGTTTACCATCTAACTTTCATCCGAACAATCTTGTTATATGCAAGTTACCTGACAGTTGTATGACGTCGTTTGAGTTCCATGGCCCATCGAAGTTCGGGCATCTAACAGTTTTGAAGTTTGACAACTGCAAATTTTTAACACAGATACCTGATGTATCTGATCTCCCAAATTTGAGGGAACTTTCATTTGAAGAGTGTGAGAGTTTAGTTGCAGTTGATGACTCAATTGGTTTTCTGAATAAACTTAAAAAATTGAGTGCGTATGGTTGCAGCAAGCTTAAGAGTTTTCCGCCTCTCAACTTGACCTCTCTTCAAACACTTGAACTTTCTCAATGTTCCAGTCTTGAATATTTTCCAGAAATAATAGGAGAGATGGAAAACATAAAGCATCTTTTTTTGTATGGCCTTCCCATAAAAGAATTGTCATTTTCATTTCAAAATCTTATTGGACTCCGTTGGTTAACCCTGAGGAGCTGTGGAATTGTTAAGTTACCATGTAGCTTAGCGATGATGCCCGAACTGTTTGAATTCCATATGGAATATTGCAACAGGTGGCAATGGGTAGAATCGGAAGAAGGTGAAAAAAAAGTGGGCTCAATACCATCTTCAAAGGCACATCGGTTTTCGGCCAAGGATTGCAATCTATGTGATGATTTTTTTTTAACAGGTTTCAAGACCTTTGCTCGTGTAGGACATTTAAATCTGTCGGGGAATAATTTCACAATCCTTCCTGAATTCTTCAAAGAATTGCAATTATTAAGATCACTTATGGTGAGTGATTGCGAGCATCTTCAGGAAATTAGAGGTCTTCCACCAAACTTAGAGTATTTCGATGCAAGAAACTGTGCATCCTTGACTTCCTCGAGTAAAAACATGCTTTTAAATCAGGTATTGTCTTTTTTGTTACTGTACAGGATTTGA


Protein sequences

Name Description Sequence
R 10 protein R 10 protein [Glycine max].

MAATTRSRASIYDVFLNFRGGDTRYGFTGNLYRALCDKGIHTFFDEKKLHRGEEITPALLKAIQESRIAITVLSKNYASSSFCLDELVTILHCKSEGLLVIPVFYNVDPSDVRHQKGSYGVEMAKHQKRFKAKKEKLQKWRIALKQVADLCGYHFKDGDAYEYKFIQSIVEQVSREINRAPLHVADYPVGLGSQVIEVRKLLDVGSHDVVHIIGIHGMGGLGKTTLALAVYNLIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKREQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVLNQSAALQLLKWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNLFGKTVAEWESAMEHYKRIPSDEILEILKVSFDALGEEQKNVFLDIACCFRGYKWTEVDDILRALYGNCKKHHIGVLVEKSLIKLNCYGTDTVEMHDLIQDMAREIERKRSPQEPGKCKRLWLPKDIIQVFKDNTGTSKIEIICLDSSISDKEETVEWNENAFMKMENLKILIIRNDKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFHPNNLVICKLPDSCMTSFEFHGPSKFGHLTVLKFDNCKFLTQIPDVSDLPNLRELSFEECESLVAVDDSIGFLNKLKKLSAYGCSKLKSFPPLNLTSLQTLELSQCSSLEYFPEIIGEMENIKHLFLYGLPIKELSFSFQNLIGLRWLTLRSCGIVKLPCSLAMMPELFEFHMEYCNRWQWVESEEGEKKVGSIPSSKAHRFSAKDCNLCDDFFLTGFKTFARVGHLNLSGNNFTILPEFFKELQLLRSLMVSDCEHLQEIRGLPPNLEYFDARNCASLTSSSKNMLLNQVLSFLLLYRI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MAATTRSRASIYDVFLNFRGGDTRYGFTGNLYRALCDKGIHTFFDEKKLHRGEEITPALLKAIQESRIAITVLSKNYASSSFCLDELVTILHCKSEGLLVIPVFYNVDPSDVRHQKGSYGVEMAKHQKRFKAKKEKLQKWRIALKQVADLCGY

ProfileScan: PS50104
IPR000157
10-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SIYDVFLNFRGGDTRYGFTGNLYRALCDKGIHTFFDEKKLHRGEEITPALLKAIQESRIAITVLSKNYASSSFCLDELVTILHCKSEGLLVIPVFYNVDPSDVRHQKGSYGVEMAKHQKRFKAKKEKLQKWRIALKQVADL

Gene3D: G3DSA:3.40.50.10140
10-140 G3DSA:3.40.50.10140

SIYDVFLNFRGGDTRYGFTGNLYRALCDKGIHTFFDEKKLHRGEEITPALLKAIQESRIAITVLSKNYASSSFCLDELVTILHCKSEGLLVIPVFYNVDPSDVRHQKGSYGVEMAKHQKRFKAKKEKLQKW

HMMSmart: SM00255
IPR000157
11-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

IYDVFLNFRGGDTRYGFTGNLYRALCDKGIHTFFDEKKLHRGEEITPALLKAIQESRIAITVLSKNYASSSFCLDELVTILHCKSEGLLVIPVFYNVDPSDVRHQKGSYGVEMAKHQKRFKAKKEKLQKWRIALKQVADL

HMMPfam: PF01582
IPR000157
14-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLNFRGGDTRYGFTGNLYRALCDKGIHTFFDEKKLHRGEEITPALLKAIQESRIAITVLSKNYASSSFCLDELVTILHCKSEGLLVIPVFYNVDPSDVRHQKGSYGVEMAKHQKRFKAKKEKLQKWRIALKQ

HMMPanther: PTHR11017
38-895 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KGIHTFFDEKKLHRGEEITPALLKAIQESRIAITVLSKNYASSSFCLDELVTILHCKSEGLLVIPVFYNVDPSDVRHQKGSYGVEMAKHQKRFKAKKEKLQKWRIALKQVADLCGYHFKDGDAYEYKFIQSIVEQVSREINRAPLHVADYPVGLGSQVIEVRKLLDVGSHDVVHIIGIHGMGGLGKTTLALAVYNLIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKREQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVLNQSAALQLLKWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNLFGKTVAEWESAMEHYKRIPSDEILEILKVSFDALGEEQKNVFLDIACCFRGYKWTEVDDILRALYGNCKKHHIGVLVEKSLIKLNCYGTDTVEMHDLIQDMAREIERKRSPQEPGKCKRLWLPKDIIQVFKDNTGTSKIEIICLDSSISDKEETVEWNENAFMKMENLKILIIRNDKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFHPNNLVICKLPDSCMTSFEFHGPSKFGHLTVLKFDNCKFLTQIPDVSDLPNLRELSFEECESLVAVDDSIGFLNKLKKLSAYGCSKLKSFPPLNLTSLQTLELSQCSSLEYFPEIIGEMENIKHLFLYGLPIKELSFSFQNLIGLRWLTLRSCGIVKLPCSLAMMPELFEFHMEYCNRWQWVESEEGEKKVGSIPSSKAHRFSAKDCNLCDDFFLTGFKTFARVGHLNLSGNNFTILPEFFKELQLLRSLMVSDCEHLQEIRGLPPNLEYFDARNCASLTSSSKNMLLNQVLSF

HMMPanther: PTHR11017:SF20
38-895 PTHR11017:SF20,SUBFAMILY NOT NAMED

KGIHTFFDEKKLHRGEEITPALLKAIQESRIAITVLSKNYASSSFCLDELVTILHCKSEGLLVIPVFYNVDPSDVRHQKGSYGVEMAKHQKRFKAKKEKLQKWRIALKQVADLCGYHFKDGDAYEYKFIQSIVEQVSREINRAPLHVADYPVGLGSQVIEVRKLLDVGSHDVVHIIGIHGMGGLGKTTLALAVYNLIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKREQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVLNQSAALQLLKWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNLFGKTVAEWESAMEHYKRIPSDEILEILKVSFDALGEEQKNVFLDIACCFRGYKWTEVDDILRALYGNCKKHHIGVLVEKSLIKLNCYGTDTVEMHDLIQDMAREIERKRSPQEPGKCKRLWLPKDIIQVFKDNTGTSKIEIICLDSSISDKEETVEWNENAFMKMENLKILIIRNDKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFHPNNLVICKLPDSCMTSFEFHGPSKFGHLTVLKFDNCKFLTQIPDVSDLPNLRELSFEECESLVAVDDSIGFLNKLKKLSAYGCSKLKSFPPLNLTSLQTLELSQCSSLEYFPEIIGEMENIKHLFLYGLPIKELSFSFQNLIGLRWLTLRSCGIVKLPCSLAMMPELFEFHMEYCNRWQWVESEEGEKKVGSIPSSKAHRFSAKDCNLCDDFFLTGFKTFARVGHLNLSGNNFTILPEFFKELQLLRSLMVSDCEHLQEIRGLPPNLEYFDARNCASLTSSSKNMLLNQVLSF

superfamily: SSF52540
171-418 SSF52540

EQVSREINRAPLHVADYPVGLGSQVIEVRKLLDVGSHDVVHIIGIHGMGGLGKTTLALAVYNLIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKREQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVLNQSAALQLLKWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNLFGKTVAEWESAMEHYKRIPSDEI

HMMPfam: PF00931
IPR002182
198-451 NB-ARC,NBS
NB-ARC

VRKLLDVGSHDVVHIIGIHGMGGLGKTTLALAVYNLIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKREQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVLNQSAALQLLKWNAFKREKIDPSYEDVLNRVVTYASGLPLALEVIGSNLFGKTVAEWESAMEHYKRIPSDEILEILKVSFDALGEEQKNVFLDIACCFRGYKWTE

HMMSmart: SM00382
IPR003593
209-347 AAA,NBS
AAA+ ATPase domain

VVHIIGIHGMGGLGKTTLALAVYNLIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKREQLKAIVGRPDWFGPGSRVIITTRDKHLLKYHEVERTYEVKVL

Gene3D: G3DSA:3.40.50.300
211-334 G3DSA:3.40.50.300

HIIGIHGMGGLGKTTLALAVYNLIALHFDESCFLQNVREESNKHGLKHLQSILLSKLLGEKDITLTSWQEGASMIQHRLQRKKVLLILDDVDKREQLKAIVGRPDWFGPGSRVIITTRDKHLLK

FPrintScan: PR00364
IPR000767
212-227 DISEASERSIST
Disease resistance protein

IIGIHGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
288-302 DISEASERSIST
Disease resistance protein

RLQRKKVLLILDDVD

FPrintScan: PR00364
IPR000767
381-395 DISEASERSIST
Disease resistance protein

ASGLPLALEVIGSNL

superfamily: SSF46785
416-526 SSF46785

DEILEILKVSFDALGEEQKNVFLDIACCFRGYKWTEVDDILRALYGNCKKHHIGVLVEKSLIKLNCYGTDTVEMHDLIQDMAREIERKRSPQEPGKCKRLWLPKDIIQVFK

superfamily: SSF52058
500-899 SSF52058,LRR

IERKRSPQEPGKCKRLWLPKDIIQVFKDNTGTSKIEIICLDSSISDKEETVEWNENAFMKMENLKILIIRNDKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFHPNNLVICKLPDSCMTSFEFHGPSKFGHLTVLKFDNCKFLTQIPDVSDLPNLRELSFEECESLVAVDDSIGFLNKLKKLSAYGCSKLKSFPPLNLTSLQTLELSQCSSLEYFPEIIGEMENIKHLFLYGLPIKELSFSFQNLIGLRWLTLRSCGIVKLPCSLAMMPELFEFHMEYCNRWQWVESEEGEKKVGSIPSSKAHRFSAKDCNLCDDFFLTGFKTFARVGHLNLSGNNFTILPEFFKELQLLRSLMVSDCEHLQEIRGLPPNLEYFDARNCASLTSSSKNMLLNQVLSFLLLY

Gene3D: G3DSA:3.80.10.10
550-778 G3DSA:3.80.10.10

VEWNENAFMKMENLKILIIRNDKFSKGPNYFPEGLRVLEWHRYPSNCLPSNFHPNNLVICKLPDSCMTSFEFHGPSKFGHLTVLKFDNCKFLTQIPDVSDLPNLRELSFEECESLVAVDDSIGFLNKLKKLSAYGCSKLKSFPPLNLTSLQTLELSQCSSLEYFPEIIGEMENIKHLFLYGLPIKELSFSFQNLIGLRWLTLRSCGIVKLPCSLAMMPELFEFHMEYCN

HMMPfam: PF13504
628-645 LRR_7,Leucine rich repeat

GHLTVLKFDNCKFLTQIP

FPrintScan: PR00364
IPR000767
694-710 DISEASERSIST
Disease resistance protein

LNLTSLQTLELSQCSSL

HMMPfam: PF00560
IPR001611
827-844 LRR_1
Leucine-rich repeat

HLNLSGNNFTILPEFFKE

Gene3D: G3DSA:3.80.10.10
827-881 G3DSA:3.80.10.10

HLNLSGNNFTILPEFFKELQLLRSLMVSDCEHLQEIRGLPPNLEYFDARNCASLT


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox