PRGDB00050754 (R 11)

From PRG Wiki
Jump to: navigation, search
R 11
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 27764534 (AF541963)
Gene Class T
Domain Type TIR, LRR
Gene Species Glycine max

Comment?

Glycine max cv Williams 82 BAC clone Gm_ISb001_091_F11, complete sequence.

DNA Sequence

ATGGCTGCAACAACACGTTCCTGTGCATCCATCTACGATGTGTTCCTCAGCTTCAAAGGGAAAGACACCCGTCAAGATTTTACTGGCTATGTCTACAAAGCTCTTGATGACAGGGGAATCTACACTTTCATTGATGATGAGGAGCTTCCGAGAGGAGACAAAATAGCACCTGCACTTTTCAGTTTTTTAAATCCTCAACTCGTCTTCGTAATTTGTGTATCTTTTTGCTTTTAA


Protein sequences

Name Description Sequence
R fragment A protein R fragment A protein [Glycine max].

MAATTRSCASIYDVFLSFKGKDTRQDFTGYVYKALDDRGIYTFIDDEELPRGDKIAPALFSFLNPQLVFVICVSFCF

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-74 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MAATTRSCASIYDVFLSFKGKDTRQDFTGYVYKALDDRGIYTFIDDEELPRGDKIAPALFSFLNPQLVFVICVS

ProfileScan: PS50104
IPR000157
10-77 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SIYDVFLSFKGKDTRQDFTGYVYKALDDRGIYTFIDDEELPRGDKIAPALFSFLNPQLVFVICVSFCF

Gene3D: G3DSA:3.40.50.10140
11-63 G3DSA:3.40.50.10140

IYDVFLSFKGKDTRQDFTGYVYKALDDRGIYTFIDDEELPRGDKIAPALFSFL

HMMPfam: PF01582
IPR000157
14-62 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFKGKDTRQDFTGYVYKALDDRGIYTFIDDEELPRGDKIAPALFSF


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox