PRGDB00050760 (R 11)

From PRG Wiki
Jump to: navigation, search
R 11
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 27764534 (AF541963)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Glycine max

Comment?

Glycine max cv Williams 82 BAC clone Gm_ISb001_091_F11, complete sequence.

DNA Sequence

GCTTCACAGCGGAGAGGAAATAACACCTGCACTTTTGAAGGCAATTCAAGATTCCAGGGTTGCTATTATTGTGCTTTCTGAAAACTATGCTTTTTCCTCATTTTGTTTAGATGAACTTGTAACCATCTTTCACTGCAAGAGGGAAGGGCTGTTGGTTATACCGGTCTTTTACAAAGTAGATCCTTCTTATGTCAGACACCAGAAAGGTAGTTATGGAGAAGCAATGACTAAGCATCAGGAAAGGTTCAAAGATAAGATGGAGAAGCTGCAGGAATGGAGGATGGCTTTGAAACAAGTAGCTGACTTGTCTGGCTCTCATTTCAAAGATGGAGGTTCATATGAATACGAGTTTATTGGGAGTATTGTCGAGGAGGTCTCTAGGAAGATTGGTCGTGGTTCTTTACATGTTGCGGATTATCCGGTTGGTCAAGCGTCACAAGTGACAGAGGTAATGAAGCTTTTGGATGTTGGATCCGATGATGTTGTCCATATCATAGGGATCTATGGGATGCGTGGGTTAGGAAAAACAACCCTTGCTCTAGATGTTTATAATTCGATTGCTCGTCATTTTGATGAATCCTGTTTTCTTCAAAACGTGAGAGAAGAATCAAAGAAACATGGGTTAAAACACCTTCAAAGCATCATTATTTCAAAATTACTTGGTGAGAAGGACATCAACTTAGCAAGTTATCGAGAAGGAGCTTCAATGATACAAAGTAGGCTCCGAAGAAAGAAGGTTCTCTTGATTTTAGACGATGTCAACAAGCGCGAGCAATTAAAGGCTATTGTTGGAAGATCTGATTGGTTTGGTCCCGGTAGCAGAGTCATCATTACCACTCGGTACAAACGTCTGCTAAAAGATCACGAGGTTGAAAGAACTTATAAGGTGAAACTGCTGTCGGTGTTCAACAGAGAATGA


Protein sequences

Name Description Sequence
R 2 protein R 2 protein [Glycine max].

LHSGEEITPALLKAIQDSRVAIIVLSENYAFSSFCLDELVTIFHCKREGLLVIPVFYKVDPSYVRHQKGSYGEAMTKHQERFKDKMEKLQEWRMALKQVADLSGSHFKDGGSYEYEFIGSIVEEVSRKIGRGSLHVADYPVGQASQVTEVMKLLDVGSDDVVHIIGIYGMRGLGKTTLALDVYNSIARHFDESCFLQNVREESKKHGLKHLQSIIISKLLGEKDINLASYREGASMIQSRLRRKKVLLILDDVNKREQLKAIVGRSDWFGPGSRVIITTRYKRLLKDHEVERTYKVKLLSVFNRE

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
1-102 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LHSGEEITPALLKAIQDSRVAIIVLSENYAFSSFCLDELVTIFHCKREGLLVIPVFYKVDPSYVRHQKGSYGEAMTKHQERFKDKMEKLQEWRMALKQVADL

superfamily: SSF52200
IPR000157
1-105 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LHSGEEITPALLKAIQDSRVAIIVLSENYAFSSFCLDELVTIFHCKREGLLVIPVFYKVDPSYVRHQKGSYGEAMTKHQERFKDKMEKLQEWRMALKQVADLSGS

Gene3D: G3DSA:3.40.50.10140
2-92 G3DSA:3.40.50.10140

HSGEEITPALLKAIQDSRVAIIVLSENYAFSSFCLDELVTIFHCKREGLLVIPVFYKVDPSYVRHQKGSYGEAMTKHQERFKDKMEKLQEW

HMMPfam: PF01582
IPR000157
3-98 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SGEEITPALLKAIQDSRVAIIVLSENYAFSSFCLDELVTIFHCKREGLLVIPVFYKVDPSYVRHQKGSYGEAMTKHQERFKDKMEKLQEWRMALKQ

HMMPanther: PTHR23155
21-277 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AIIVLSENYAFSSFCLDELVTIFHCKREGLLVIPVFYKVDPSYVRHQKGSYGEAMTKHQERFKDKMEKLQEWRMALKQVADLSGSHFKDGGSYEYEFIGSIVEEVSRKIGRGSLHVADYPVGQASQVTEVMKLLDVGSDDVVHIIGIYGMRGLGKTTLALDVYNSIARHFDESCFLQNVREESKKHGLKHLQSIIISKLLGEKDINLASYREGASMIQSRLRRKKVLLILDDVNKREQLKAIVGRSDWFGPGSRVII

HMMPanther: PTHR23155:SF344
21-277 PTHR23155:SF344

AIIVLSENYAFSSFCLDELVTIFHCKREGLLVIPVFYKVDPSYVRHQKGSYGEAMTKHQERFKDKMEKLQEWRMALKQVADLSGSHFKDGGSYEYEFIGSIVEEVSRKIGRGSLHVADYPVGQASQVTEVMKLLDVGSDDVVHIIGIYGMRGLGKTTLALDVYNSIARHFDESCFLQNVREESKKHGLKHLQSIIISKLLGEKDINLASYREGASMIQSRLRRKKVLLILDDVNKREQLKAIVGRSDWFGPGSRVII

superfamily: SSF52540
123-291 SSF52540

EEVSRKIGRGSLHVADYPVGQASQVTEVMKLLDVGSDDVVHIIGIYGMRGLGKTTLALDVYNSIARHFDESCFLQNVREESKKHGLKHLQSIIISKLLGEKDINLASYREGASMIQSRLRRKKVLLILDDVNKREQLKAIVGRSDWFGPGSRVIITTRYKRLLKDHEVE

HMMPfam: PF00931
IPR002182
145-300 NB-ARC,NBS
NB-ARC

SQVTEVMKLLDVGSDDVVHIIGIYGMRGLGKTTLALDVYNSIARHFDESCFLQNVREESKKHGLKHLQSIIISKLLGEKDINLASYREGASMIQSRLRRKKVLLILDDVNKREQLKAIVGRSDWFGPGSRVIITTRYKRLLKDHEVERTYKVKLLS

Gene3D: G3DSA:3.40.50.300
145-288 G3DSA:3.40.50.300

SQVTEVMKLLDVGSDDVVHIIGIYGMRGLGKTTLALDVYNSIARHFDESCFLQNVREESKKHGLKHLQSIIISKLLGEKDINLASYREGASMIQSRLRRKKVLLILDDVNKREQLKAIVGRSDWFGPGSRVIITTRYKRLLKDH

FPrintScan: PR00364
IPR000767
164-179 DISEASERSIST
Disease resistance protein

IIGIYGMRGLGKTTLA

FPrintScan: PR00364
IPR000767
240-254 DISEASERSIST
Disease resistance protein

RLRRKKVLLILDDVN


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox