PRGDB00050822 (serine/threonine protein kinase)

From PRG Wiki
Jump to: navigation, search
serine/threonine protein kinase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21483857 (AY113701)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza rufipogon

Comment?

Oryza rufipogon serine/threonine protein kinase gene, partial cds.

DNA Sequence

TTTTGGGTCGGTGTATCGGGGGAGGCTGAGCATCAAGGGGACTGTGACGGAGGCGGCGGTGAAGCAGCTGGACCGGAACGGGATGCAGGGGAACCGGGAGTTCCTTGTGGAGGTGCTGATGCTGAGCCTGCTGGCGGAGCACCCAAACCTGGTGACGCTGCTGGGGTACTGCACCGACGGCGATCACCGCATCCTGGTGTACGAGTACATGGCCCGCGGCTCCCTGGAGGACCACCTGCTTGACCTGCCCCCTGGCGCCGCGGCTCTGGACTGGACCACTCGGATGCGCATCGCGCAGGGCGCCGCCCGCGGCCTTGAGCACCTGCACGACGCTGCTCGTCCCCCCGTCATCTACCGCGACTTCAAGGCCTCCAACATCCTCCTCGACTCCTCCCTCCAGGCCCGCCCCTCCGACTTCGGCCTCGCCAAGGTCGGCCCCGTCGGCGACAGGACCCACGTCTCCACCCGCGTCATGGGCACCTACGGCTACTGCGCCCCCGAGTACGCTCTCACCGGCAAGCTCACCACCTGCTCCGACGTCTACAGCTTCGGCGT


Protein sequences

Name Description Sequence
serine/threonine protein kinase serine/threonine protein kinase [Oryza rufipogon].

FGSVYRGRLSIKGTVTEAAVKQLDRNGMQGNREFLVEVLMLSLLAEHPNLVTLLGYCTDGDHRILVYEYMARGSLEDHLLDLPPGAAALDWTTRMRIAQGAARGLEHLHDAARPPVIYRDFKASNILLDSSLQARPSDFGLAKVGPVGDRTHVSTRVMGTYGYCAPEYALTGKLTTCSDVYSFGV

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-185 Kinase_like
Protein kinase-like domain

FGSVYRGRLSIKGTVTEAAVKQLDRNGMQGNREFLVEVLMLSLLAEHPNLVTLLGYCTDGDHRILVYEYMARGSLEDHLLDLPPGAAALDWTTRMRIAQGAARGLEHLHDAARPPVIYRDFKASNILLDSSLQARPSDFGLAKVGPVGDRTHVSTRVMGTYGYCAPEYALTGKLTTCSDVYSFGV

HMMPanther: PTHR24420:SF657
1-185 PTHR24420:SF657

FGSVYRGRLSIKGTVTEAAVKQLDRNGMQGNREFLVEVLMLSLLAEHPNLVTLLGYCTDGDHRILVYEYMARGSLEDHLLDLPPGAAALDWTTRMRIAQGAARGLEHLHDAARPPVIYRDFKASNILLDSSLQARPSDFGLAKVGPVGDRTHVSTRVMGTYGYCAPEYALTGKLTTCSDVYSFGV

HMMPanther: PTHR24420
1-185 PTHR24420,FAMILY NOT NAMED

FGSVYRGRLSIKGTVTEAAVKQLDRNGMQGNREFLVEVLMLSLLAEHPNLVTLLGYCTDGDHRILVYEYMARGSLEDHLLDLPPGAAALDWTTRMRIAQGAARGLEHLHDAARPPVIYRDFKASNILLDSSLQARPSDFGLAKVGPVGDRTHVSTRVMGTYGYCAPEYALTGKLTTCSDVYSFGV

Gene3D: G3DSA:3.30.200.20
1-57 G3DSA:3.30.200.20

FGSVYRGRLSIKGTVTEAAVKQLDRNGMQGNREFLVEVLMLSLLAEHPNLVTLLGYC

HMMPfam: PF07714
IPR001245
1-185 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

FGSVYRGRLSIKGTVTEAAVKQLDRNGMQGNREFLVEVLMLSLLAEHPNLVTLLGYCTDGDHRILVYEYMARGSLEDHLLDLPPGAAALDWTTRMRIAQGAARGLEHLHDAARPPVIYRDFKASNILLDSSLQARPSDFGLAKVGPVGDRTHVSTRVMGTYGYCAPEYALTGKLTTCSDVYSFGV

ProfileScan: PS50011
IPR000719
1-185 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGSVYRGRLSIKGTVTEAAVKQLDRNGMQGNREFLVEVLMLSLLAEHPNLVTLLGYCTDGDHRILVYEYMARGSLEDHLLDLPPGAAALDWTTRMRIAQGAARGLEHLHDAARPPVIYRDFKASNILLDSSLQARPSDFGLAKVGPVGDRTHVSTRVMGTYGYCAPEYALTGKLTTCSDVYSFGV

Gene3D: G3DSA:1.10.510.10
58-185 G3DSA:1.10.510.10

TDGDHRILVYEYMARGSLEDHLLDLPPGAAALDWTTRMRIAQGAARGLEHLHDAARPPVIYRDFKASNILLDSSLQARPSDFGLAKVGPVGDRTHVSTRVMGTYGYCAPEYALTGKLTTCSDVYSFGV

PatternScan: PS00108
IPR008271
116-128 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox