PRGDB00050827 (protein kinase homolog D3)

From PRG Wiki
Jump to: navigation, search
protein kinase homolog D3
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6648995 (AF121452)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Capsicum annuum

Comment?

Capsicum annuum protein kinase homolog D3 gene, partial cds.

DNA Sequence

GACTAGTGGATGTGAAGTAGCTCTGAAGAGGTTCAAGAATTGTTCGGCAGGTGGTGATTCGAGTTTTATTCATGAATTGGAGGTAATTGCCAGTGTTAGGCATGTCAATTTGTTAGGCTTGAGAGGATATTGCACTGCCACATTTCCTTTGGAGGGTCACCAGAGGATTATTGTCTGTGATTTGGTGAAACATGGCAGTCTGTATGATCATTTATTTGGGTTGAGATGCAACAAATTGAGTTGGCCCATTAGGCAGAGAATTGCAATTGGCACTGCTCGAGGCTTAGCTTACTTGCATTACGGAGCACAACCGGCTATCATTCATAGGGATATAAAGTCTAGTAATATACTTTTAGATGAGAATTTTGAGCCCAAGGTTGCGGACTTCGGCCTCGCCAAACTC


Protein sequences

Name Description Sequence
protein kinase homolog D3 protein kinase homolog D3 [Capsicum annuum].

TSGCEVALKRFKNCSAGGDSSFIHELEVIASVRHVNLLGLRGYCTATFPLEGHQRIIVCDLVKHGSLYDHLFGLRCNKLSWPIRQRIAIGTARGLAYLHYGAQPAIIHRDIKSSNILLDENFEPKVADFGLAKL

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-134 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

TSGCEVALKRFKNCSAGGDSSFIHELEVIASVRHVNLLGLRGYCTATFPLEGHQRIIVCDLVKHGSLYDHLFGLRCNKLSWPIRQRIAIGTARGLAYLHYGAQPAIIHRDIKSSNILLDENFEPKVADFGLAKL

superfamily: SSF56112
IPR011009
3-134 Kinase_like
Protein kinase-like domain

GCEVALKRFKNCSAGGDSSFIHELEVIASVRHVNLLGLRGYCTATFPLEGHQRIIVCDLVKHGSLYDHLFGLRCNKLSWPIRQRIAIGTARGLAYLHYGAQPAIIHRDIKSSNILLDENFEPKVADFGLAKL

HMMPanther: PTHR24420
3-134 PTHR24420,FAMILY NOT NAMED

GCEVALKRFKNCSAGGDSSFIHELEVIASVRHVNLLGLRGYCTATFPLEGHQRIIVCDLVKHGSLYDHLFGLRCNKLSWPIRQRIAIGTARGLAYLHYGAQPAIIHRDIKSSNILLDENFEPKVADFGLAKL

Gene3D: G3DSA:3.30.200.20
3-56 G3DSA:3.30.200.20

GCEVALKRFKNCSAGGDSSFIHELEVIASVRHVNLLGLRGYCTATFPLEGHQRI

HMMPfam: PF00069
IPR000719
3-133 Pkinase,Ser-thr
Protein kinase, catalytic domain

GCEVALKRFKNCSAGGDSSFIHELEVIASVRHVNLLGLRGYCTATFPLEGHQRIIVCDLVKHGSLYDHLFGLRCNKLSWPIRQRIAIGTARGLAYLHYGAQPAIIHRDIKSSNILLDENFEPKVADFGLAK

HMMPanther: PTHR24420:SF895
3-134 PTHR24420:SF895

GCEVALKRFKNCSAGGDSSFIHELEVIASVRHVNLLGLRGYCTATFPLEGHQRIIVCDLVKHGSLYDHLFGLRCNKLSWPIRQRIAIGTARGLAYLHYGAQPAIIHRDIKSSNILLDENFEPKVADFGLAKL

Gene3D: G3DSA:1.10.510.10
57-133 G3DSA:1.10.510.10

IVCDLVKHGSLYDHLFGLRCNKLSWPIRQRIAIGTARGLAYLHYGAQPAIIHRDIKSSNILLDENFEPKVADFGLAK

PatternScan: PS00108
IPR008271
106-118 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL


List of References

S Pflieger, V Lefebvre, C Caranta, A Blattes, B Goffinet, A Palloix
Disease resistance gene analogs as candidates for QTLs involved in pepper-pathogen interactions.
Genome: 1999, 42(6);1100-10
PubMed:10659776 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox