PRGDB00050839 (RGA38)

From PRG Wiki
Jump to: navigation, search
RGA38
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12330425 (AF263321)
Gene Class CNL
Domain Type NBS, LRR
Gene Species Brassica napus

Comment?

Brassica napus disease resistance-like protein (RGA38) gene, partial cds.

DNA Sequence

CGGGAGAAGATTGCTCAAGTGTTGGAAACACAAAAGGCTTTGATCGTCATTGATGATATATGGAGAGAAGGAGACTGGGACCTAATCAAGCCTGTCTTTCTGCTAAATAAAGGATGTAAGGTTTTACTTACTTCTCGCAATGAGAGAGTGGCATTACATGCAGACGAACAATGCAACCCCATCAAACCAGAGTGCCTAACTTTTGAAGAAAGTTGGGTTCTTTTTCAAAGGATAGCATTTCCTATTAAAGACACAGCTGAATGCAANATTGACGAAG


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Brassica napus].

REKIAQVLETQKALIVIDDIWREGDWDLIKPVFLLNKGCKVLLTSRNERVALHADEQCNPIKPECLTFEESWVLFQRIAFPIKDTAECXIDE


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-81 SSF52540

REKIAQVLETQKALIVIDDIWREGDWDLIKPVFLLNKGCKVLLTSRNERVALHADEQCNPIKPECLTFEESWVLFQRIAFP

HMMPfam: PF00931
IPR002182
2-83 NB-ARC,NBS
NB-ARC

EKIAQVLETQKALIVIDDIWREGDWDLIKPVFLLNKGCKVLLTSRNERVALHADEQCNPIKPECLTFEESWVLFQRIAFPIK

HMMPanther: PTHR11017
6-87 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QVLETQKALIVIDDIWREGDWDLIKPVFLLNKGCKVLLTSRNERVALHADEQCNPIKPECLTFEESWVLFQRIAFPIKDTAE

HMMPanther: PTHR11017:SF125
6-87 PTHR11017:SF125,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

QVLETQKALIVIDDIWREGDWDLIKPVFLLNKGCKVLLTSRNERVALHADEQCNPIKPECLTFEESWVLFQRIAFPIKDTAE


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox