PRGDB00050855 (RGA30)

From PRG Wiki
Jump to: navigation, search
RGA30
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 11761683 (AF209499)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Brassica napus

Comment?

Brassica napus disease resistance-like protein (RGA30) gene, partial cds.

DNA Sequence

TGGTGGGGTTGGGAAAACAACCCTTTTCAAGAAAATCCACAATAGGTTTGCTGGAACAGCTGAAAAGCTTGACATTTTGATATGGATTGTGGTGTCTCAAGGCGAAAATATTTCAAAGCTTCAAGAAGATATTGCACGGAAGCTACACCTTTGTGGCGAGGAATGGACAAACAAAAATGAAAGTGATAAAGCCGCAGAGATTCACACAGTTTTAAAAAGGCAGAGATTTGTGCTGATGCTAGATGACATATGGGAGAAAATGGATTTAGAAGCCATCAGAGTTCCGGAACCAACCATAGAAAATGGATGCAAAGTAGTATTCACCACCCGTTCTGAGGATGTATGTAAGAGGATGGGGGATCATCAACCCATGCAAGTCAAGTGTTTGAAAGAAGATCAAGCATGGGAATTATTTAAACTCAAAATAGGATATGAAAAGTTAAGGAGAGAGCCCCGCATTGACGGCCTCACTAGAAAGGTTGCGGAAAAATGTCATGGGCTGCCACTAGCGTTGA


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Brassica napus].

GGVGKTTLFKKIHNRFAGTAEKLDILIWIVVSQGENISKLQEDIARKLHLCGEEWTNKNESDKAAEIHTVLKRQRFVLMLDDIWEKMDLEAIRVPEPTIENGCKVVFTTRSEDVCKRMGDHQPMQVKCLKEDQAWELFKLKIGYEKLRREPRIDGLTRKVAEKCHGLPLAL

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-171 NB-ARC,NBS
NB-ARC

GGVGKTTLFKKIHNRFAGTAEKLDILIWIVVSQGENISKLQEDIARKLHLCGEEWTNKNESDKAAEIHTVLKRQRFVLMLDDIWEKMDLEAIRVPEPTIENGCKVVFTTRSEDVCKRMGDHQPMQVKCLKEDQAWELFKLKIGYEKLRREPRIDGLTRKVAEKCHGLPLAL

HMMPanther: PTHR23155
1-106 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLFKKIHNRFAGTAEKLDILIWIVVSQGENISKLQEDIARKLHLCGEEWTNKNESDKAAEIHTVLKRQRFVLMLDDIWEKMDLEAIRVPEPTIENGCKVV

HMMPanther: PTHR23155:SF117
1-106 PTHR23155:SF117,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

GGVGKTTLFKKIHNRFAGTAEKLDILIWIVVSQGENISKLQEDIARKLHLCGEEWTNKNESDKAAEIHTVLKRQRFVLMLDDIWEKMDLEAIRVPEPTIENGCKVV

superfamily: SSF52540
1-171 SSF52540

GGVGKTTLFKKIHNRFAGTAEKLDILIWIVVSQGENISKLQEDIARKLHLCGEEWTNKNESDKAAEIHTVLKRQRFVLMLDDIWEKMDLEAIRVPEPTIENGCKVVFTTRSEDVCKRMGDHQPMQVKCLKEDQAWELFKLKIGYEKLRREPRIDGLTRKVAEKCHGLPLAL

Gene3D: G3DSA:3.40.50.300
2-120 G3DSA:3.40.50.300

GVGKTTLFKKIHNRFAGTAEKLDILIWIVVSQGENISKLQEDIARKLHLCGEEWTNKNESDKAAEIHTVLKRQRFVLMLDDIWEKMDLEAIRVPEPTIENGCKVVFTTRSEDVCKRMGD

FPrintScan: PR00364
IPR000767
70-84 DISEASERSIST
Disease resistance protein

VLKRQRFVLMLDDIW

FPrintScan: PR00364
IPR000767
164-171 DISEASERSIST
Disease resistance protein

CHGLPLAL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox