PRGDB00050868 (AT3g05370/T12H1_34)

From PRG Wiki
Jump to: navigation, search
AT3g05370/T12H1_34
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 19699331 (AY090373)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana AT3g05370/T12H1_34 mRNA, complete cds.

DNA Sequence

ATGATGATTCCAAGCCAATCTTGCTTCTGTTTTTTCTTCATGGTTTCATTCTTTCTACACACTCTTGCTTCTCCTACGCTTCGCCATTGCCGCCATGACCAAAGGAATGCTCTTCTGGAGTTCAAACACGAGTTTCCGCGGGTAAATGAATCCAACCAAATTCCTTATGATGTATCGTTAAGTTCATGGAACAAGAGCATTGATTGTTGTTCTTGGGAGGGTGTCACGTGCGATGCTATATCTAGCGAGGTGATTTCACTTAACCTTAGTCATGTTCCTCTTAATAACTCATTGAAACCAAATAGTGGTCTTTTCAAACTTCAACATCTTCATAACTTAACCCTTAGTAATTGTAGTCTCTATGGAGATATTCCTTCTTCATTAGGAAACCTTTTTCGTCTCACACTTCTTGACCTTTCGTATAATTATTTAGTTGGTCAAGTTCCACCTTCTATAGGAAACCTTTCTCGACTCACAATTCTTGACCTTTGGGATAATAAGTTAGTAGGTCAACTTCCAGCTTCAATAGGAAACCTAACCCAACTAGAATACTTGATCTTTTCACACAACAAATTCAGTGGCAATATTCCTGTTACATTCTCCAATTTAACAAAACTGCTCGTTGTCAACCTCTATAATAATTCCTTCGAATCCATGCTCCCACTTGACATGAGTGGATTCCAAAACTTGGACTATTTTAATGTTGGTGAAAACTCATTTTCCGGGACTTTGCCTAAATCTTTGTTCACAATTCCTTCATTACGTTGGGCTAATTTAGAGGGAAACATGTTCAAGGGACCTATAGAGTTTAGGAATATGTATTCACCATCTACTAGGCTTCAATATCTATTTCTTTCTCAAAACAAATTTGATGGCCCAATCCCTGATACTCTATCCCAATATCTCAATCTCATAGAGTTAGATCTTAGTTTCAACAATCTAACTGGATCTTTCCCTACGTTCTTGTTCACAATTCCCACGTTAGAAAGGGTTAACTTAGAGGGAAACCATCTCAAGGGACCTGTAGAGTTTGGAAACATGTCTTCATCGTCTAGTCTCAAGTTTCTAAACTTTGCTCAAAACGAATTCAATGGCTCGATCCCCGAATCTGTATCTCAGTATCTCAATCTTGAAGAGCTACATCTTAGTTTCAACAATTTCATTGGTACAATCCCAAGATCTATATCAAAGTTAGCCAAACTTGAATATTTTTGTCTTGAAGACAATAATATGGTAGGTGAAGTACCAAGTTGGCTATGGAGATTGACAATGGTGGCACTTTCTAACAATTCTTTCAACAGTTTTGGAGAATCATCAGAAGGTCTTGATGAAACACAAGTTCAGTGGTTGGATCTTAGTTCAAATTCATTTCAAGGACCATTTCCTCATTGGATATGCAAGCTTAGATCGTTGGAGATCTTAATTATGTCCGATAATCGCTTCAACGGCTCAATTCCTCCATGTTTAAGCAGCTTCATGGTTTCTCTTACAGATTTAATTCTACGTAACAACAGTTTGAGTGGACCTCTTCCTGATATATTTGTCAATGCGACAAAGCTACTATCACTTGACGTTAGTCGCAACAAGTTGGATGGAGTACTACCAAAATCTTTGATCCATTGCAAAGCTATGCAACTTTTGAATGTGAGAAGCAACAAAATCAAGGACAAGTTTCCTTCTTGGTTAGGATCTCTACCGTCATTACATGTCCTCATCCTACGATCAAATGAGTTTTATGGGACGTTGTATCAACCCCATGCATCCATTGGGTTTCAAAGTTTAAGAGTCATTGATGTCTCACACAATGACTTGATTGGGACGTTACCGTCATTCTATTTTTCTAGTTGGCGTGAAATGAGCAGATTAACAGGAGAAGATGGCGACTTTAGACTTTCTGAGGCTCCATACATGGGAAAAGTTTTGAATGCTACTGCATTCTTTGTTGATTCAATGGAAATCGTGAACAAAGGAGTAGAGACGGAGTTTAAGCGGATCAACGAAGAAAACAAAGTCATAAACTTTTCTGGAAACAGATTTTCTGGAAATATACCTGAATCCATTGGATTGTTGAAAGAGTTACGTCATCTCAACTTGTCAAGTAATGCATTCACAGGAAATATCCCACAATCATTGGCAAATTTGATGAAGCTTGAGGCGTTAGACTTATCTCTGAATCAGTTGTCTGGTCAAATTCCTCAAGGACTTGGTAGTCTCTCGTTTATGTCAACAATGAACTTCTCTTACAACTTTCTTGAAGGTCCAGTGCCTAAAAGCACACAGTTCCAAGGTCAAAACTGTTCTGCATTCATGGAAAACCCCAAGCTCAATGGTCTCGAGGAAATATGTAGAGAAACTGATCGTGTCCCGAATCCAAAACCACAAGAATCAAAAGATTTGTCTGAGCCGGAAGAACATGTGATTAACTGGATAGCCGCGGGAATAGCTTATGGTCCTGGTGTCGTCTGTGGATTGGTAATTGGACATATATTCCTTTCACACAAACACGAGTGTTGGTTCATGGAAAAGTTTCGTCGAAAAAAGCCCAAAGTAGTCACCAGAATTGCTCGTCCCTCTAAGCATTAA


Protein sequences

Name Description Sequence
AT3g05370/T12H1_34 AT3g05370/T12H1_34 [Arabidopsis thaliana].

MMIPSQSCFCFFFMVSFFLHTLASPTLRHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRETDRVPNPKPQESKDLSEPEEHVINWIAAGIAYGPGVVCGLVIGHIFLSHKHECWFMEKFRRKKPKVVTRIARPSKH


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-840 PTHR24420,FAMILY NOT NAMED

MMIPSQSCFCFFFMVSFFLHTLASPTLRHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRETDRVPNPKPQESKDLSEPEEHVINWIAAGIAYGPGVVCGLVIGHIFLSHKHECWFM

HMMPanther: PTHR24420:SF913
1-840 PTHR24420:SF913

MMIPSQSCFCFFFMVSFFLHTLASPTLRHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRETDRVPNPKPQESKDLSEPEEHVINWIAAGIAYGPGVVCGLVIGHIFLSHKHECWFM

superfamily: SSF52058
28-348 SSF52058,LRR

RHCRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNMYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMS

Gene3D: G3DSA:3.80.10.10
30-273 G3DSA:3.80.10.10

CRHDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCDAISSEVISLNLSHVPLNNSLKPNSGLFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRNM

HMMPfam: PF08263
IPR013210
32-78 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

HDQRNALLEFKHEFPRVNESNQIPYDVSLSSWNKSIDCCSWEGVTCD

HMMPfam: PF00560
IPR001611
133-155 LRR_1
Leucine-rich repeat

RLTLLDLSYNYLVGQVPPSIGNL

HMMPfam: PF13855
156-215 LRR_8,Leucine rich repeat

SRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNKFSGNIPVTFSNLTKLLVVNLYNNS

Gene3D: G3DSA:3.80.10.10
278-427 G3DSA:3.80.10.10

TRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVAL

superfamily: SSF52047
298-503 SSF52047,LRR

LSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRN

HMMPfam: PF00560
IPR001611
303-320 LRR_1
Leucine-rich repeat

NLIELDLSFNNLTGSFPT

FPrintScan: PR00019
304-317 LEURICHRPT,Leucine-rich repeat signature

LIELDLSFNNLTGS

HMMPfam: PF00560
IPR001611
376-398 LRR_1
Leucine-rich repeat

NLEELHLSFNNFIGTIPRSISKL

Gene3D: G3DSA:3.80.10.10
428-620 G3DSA:3.80.10.10

SNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNGSIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMS

superfamily: SSF52058
493-784 SSF52058,LRR

MVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKIKDKFPSWLGSLPSLHVLILRSNEFYGTLYQPHASIGFQSLRVIDVSHNDLIGTLPSFYFSSWREMSRLTGEDGDFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENPKLNGLEEICRE

HMMPfam: PF13855
495-554 LRR_8,Leucine rich repeat

SLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCKAMQLLNVRSNKI

Gene3D: G3DSA:3.80.10.10
671-773 G3DSA:3.80.10.10

VINFSGNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIPQGLGSLSFMSTMNFSYNFLEGPVPKSTQFQGQNCSAFMENP

HMMPfam: PF00560
IPR001611
693-714 LRR_1
Leucine-rich repeat

LRHLNLSSNAFTGNIPQSLANL

FPrintScan: PR00019
714-727 LEURICHRPT,Leucine-rich repeat signature

LMKLEALDLSLNQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox