PRGDB00050873 (YK25)

From PRG Wiki
Jump to: navigation, search
YK25
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7243665 (AF230511)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa subsp. japonica serine/threonine protein kinase (YK25) gene, partial cds.

DNA Sequence

TTTGGGTCGGTGTACCGGGGGTGTTCTACTCCCAGGCAATATCCATGTTGCTGTCAAGATACTGGCCAACTATAGTTGTGACGGAGAAGAATTCATCAACGAGGTCTCCACCATTGGTAGTATCCATCATGTTAATGTTGTGTCGTTGGTGGGCTTTTGTGCCGAGGAAACAAGGAGAGCACTTGTGTACGAGTACATGCCCAATGGATCTCTGGAGAAGTACATCTTCTCGCCTGAGAAGAGTTTCTCTTGGGAAAAGCTCAATGAGATTGCACTGGGAATTGCTAGAGGAATAAACTATTTGCACCGAGGGTGTGAGATGCAAATTCTACATTTTGATATCAAGCCGCACAACATCCTTCTTGACAGCAAGTTCATTCCAAAAGTTGCTGATTTTGGCCTTGCCAAACTGTACCCACAGGATAATAGTTTTGTGCCTGTTAGTGCTGCACGAGGAACAATAGGTTATATTGCTCCTGAGATGATATCTTGGAGCTTTGGTGTCATATCTAGCAAATCTGACGTCTACAGCTACGGCATA


Protein sequences

Name Description Sequence
serine/threonine protein kinase serine/threonine protein kinase [Oryza sativa (japonica cultivar-group)].

LGRCTGGVLLPGNIHVAVKILANYSCDGEEFINEVSTIGSIHHVNVVSLVGFCAEETRRALVYEYMPNGSLEKYIFSPEKSFSWEKLNEIALGIARGINYLHRGCEMQILHFDIKPHNILLDSKFIPKVADFGLAKLYPQDNSFVPVSAARGTIGYIAPEMISWSFGVISSKSDVYSYGI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-180 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LGRCTGGVLLPGNIHVAVKILANYSCDGEEFINEVSTIGSIHHVNVVSLVGFCAEETRRALVYEYMPNGSLEKYIFSPEKSFSWEKLNEIALGIARGINYLHRGCEMQILHFDIKPHNILLDSKFIPKVADFGLAKLYPQDNSFVPVSAARGTIGYIAPEMISWSFGVISSKSDVYSYGI

superfamily: SSF56112
IPR011009
2-180 Kinase_like
Protein kinase-like domain

GRCTGGVLLPGNIHVAVKILANYSCDGEEFINEVSTIGSIHHVNVVSLVGFCAEETRRALVYEYMPNGSLEKYIFSPEKSFSWEKLNEIALGIARGINYLHRGCEMQILHFDIKPHNILLDSKFIPKVADFGLAKLYPQDNSFVPVSAARGTIGYIAPEMISWSFGVISSKSDVYSYGI

Gene3D: G3DSA:3.30.200.20
7-53 G3DSA:3.30.200.20

GVLLPGNIHVAVKILANYSCDGEEFINEVSTIGSIHHVNVVSLVGFC

HMMPanther: PTHR24420:SF441
10-180 PTHR24420:SF441,SUBFAMILY NOT NAMED

LPGNIHVAVKILANYSCDGEEFINEVSTIGSIHHVNVVSLVGFCAEETRRALVYEYMPNGSLEKYIFSPEKSFSWEKLNEIALGIARGINYLHRGCEMQILHFDIKPHNILLDSKFIPKVADFGLAKLYPQDNSFVPVSAARGTIGYIAPEMISWSFGVISSKSDVYSYGI

HMMPanther: PTHR24420
10-180 PTHR24420,FAMILY NOT NAMED

LPGNIHVAVKILANYSCDGEEFINEVSTIGSIHHVNVVSLVGFCAEETRRALVYEYMPNGSLEKYIFSPEKSFSWEKLNEIALGIARGINYLHRGCEMQILHFDIKPHNILLDSKFIPKVADFGLAKLYPQDNSFVPVSAARGTIGYIAPEMISWSFGVISSKSDVYSYGI

HMMPfam: PF00069
IPR000719
13-180 Pkinase,Ser-thr
Protein kinase, catalytic domain

NIHVAVKILANYSCDGEEFINEVSTIGSIHHVNVVSLVGFCAEETRRALVYEYMPNGSLEKYIFSPEKSFSWEKLNEIALGIARGINYLHRGCEMQILHFDIKPHNILLDSKFIPKVADFGLAKLYPQDNSFVPVSAARGTIGYIAPEMISWSFGVISSKSDVYSYGI

Gene3D: G3DSA:1.10.510.10
54-180 G3DSA:1.10.510.10

AEETRRALVYEYMPNGSLEKYIFSPEKSFSWEKLNEIALGIARGINYLHRGCEMQILHFDIKPHNILLDSKFIPKVADFGLAKLYPQDNSFVPVSAARGTIGYIAPEMISWSFGVISSKSDVYSYGI

PatternScan: PS00108
IPR008271
109-121 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHFDIKPHNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox