PRGDB00050886 (At2g20141)

From PRG Wiki
Jump to: navigation, search
At2g20141
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13605516 (AF361584)
Gene Class TNL
Domain Type TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At2g20141 mRNA, complete cds.

DNA Sequence

ATGAATTCAAGTCCTAAAATGAAACACGATGTGTTCATAAGTTTCAGGAGCAAAGACACTCGTGACAACTTCGTAAGCCATCTCTGTGGCTGTCTACGTAGGAAACGGATCAAAACCTTCTTGTATGACGAACTACCAGCTGACGAGAGGTATGAAGAGTCGTTAAAAGCAATTGAAGTATCGAAAATTTCAGTCATTGTGTTCTCGGAAAACTTTGGGGATTCGAGATGGTGTTTAGATGAAGTTGTAGCCATCTTGAAATGCAAAGAAAAGTTTGGTCAGATTGTGATACCTGTCCTTTACCATGTTGATCCTCTCGACATTGAAAATCAGACAGGAAGTTTTGGAGATGCCTTTGCTAAGCGACGGGATAAAGCCGAACAGCTTCAAGAATGGAAAGATAGTTTTACAGAAGCCATTAACCTCCCTGGATGGAGTACTGCTTATTTGAGGTATAACCCCAAACTCATACTTTCTATTAAAGTTACCGTCGTAAGTGAGCTACAAGATGTTTTAATCTCTGGGATTAATATTATGATCACTGCTTTCTCTACTTGTAAATAG


Protein sequences

Name Description Sequence
At2g20141 At2g20141 [Arabidopsis thaliana].

MNSSPKMKHDVFISFRSKDTRDNFVSHLCGCLRRKRIKTFLYDELPADERYEESLKAIEVSKISVIVFSENFGDSRWCLDEVVAILKCKEKFGQIVIPVLYHVDPLDIENQTGSFGDAFAKRRDKAEQLQEWKDSFTEAINLPGWSTAYLRYNPKLILSIKVTVVSELQDVLISGINIMITAFSTCK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SPKMKHDVFISFRSKDTRDNFVSHLCGCLRRKRIKTFLYDELPADERYEESLKAIEVSKISVIVFSENFGDSRWCLDEVVAILKCKEKFGQIVIPVLYHVDPLDIENQTGSFGDAFAKRRDKAEQLQEWKDSFTEAINLPGWSTAYLRY

Gene3D: G3DSA:3.40.50.10140
6-123 G3DSA:3.40.50.10140

KMKHDVFISFRSKDTRDNFVSHLCGCLRRKRIKTFLYDELPADERYEESLKAIEVSKISVIVFSENFGDSRWCLDEVVAILKCKEKFGQIVIPVLYHVDPLDIENQTGSFGDAFAKRR

ProfileScan: PS50104
IPR000157
7-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MKHDVFISFRSKDTRDNFVSHLCGCLRRKRIKTFLYDELPADERYEESLKAIEVSKISVIVFSENFGDSRWCLDEVVAILKCKEKFGQIVIPVLYHVDPLDIENQTGSFGDAFAKRRDKAEQLQEWKDSFTEAINL

HMMSmart: SM00255
IPR000157
8-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHDVFISFRSKDTRDNFVSHLCGCLRRKRIKTFLYDELPADERYEESLKAIEVSKISVIVFSENFGDSRWCLDEVVAILKCKEKFGQIVIPVLYHVDPLDIENQTGSFGDAFAKRRDKAEQLQEWKDSFTEAINL

HMMPfam: PF01582
IPR000157
11-133 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFISFRSKDTRDNFVSHLCGCLRRKRIKTFLYDELPADERYEESLKAIEVSKISVIVFSENFGDSRWCLDEVVAILKCKEKFGQIVIPVLYHVDPLDIENQTGSFGDAFAKRRDKAEQLQEWK

HMMPanther: PTHR23155:SF301
18-144 PTHR23155:SF301

KDTRDNFVSHLCGCLRRKRIKTFLYDELPADERYEESLKAIEVSKISVIVFSENFGDSRWCLDEVVAILKCKEKFGQIVIPVLYHVDPLDIENQTGSFGDAFAKRRDKAEQLQEWKDSFTEAINLPG

HMMPanther: PTHR23155
18-144 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KDTRDNFVSHLCGCLRRKRIKTFLYDELPADERYEESLKAIEVSKISVIVFSENFGDSRWCLDEVVAILKCKEKFGQIVIPVLYHVDPLDIENQTGSFGDAFAKRRDKAEQLQEWKDSFTEAINLPG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox