PRGDB00050888 (At1g63870/T12P18_11)

From PRG Wiki
Jump to: navigation, search
At1g63870/T12P18_11
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 17978876 (AY066043)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At1g63870/T12P18_11 mRNA, complete cds.

DNA Sequence

ATGTCTCTATTGGCTTCTTCTTCCTCTTGCAACTACAAATACATTGTCTTCCCGAGCTTTCACGGACCGGATGTCCGTAAAACACTTCTTAGTCACATGCGCAAACAGTTTGACTTCAACGGCATCACTATGTTTGATGATCAAGGGATTGAGAGAAGTGAAGAGATCGCCCCTTCACTCAAAAAGGCTATCAAAGAATCGAGGATCTCGATCGTGATTCTCTCCAAGAAATATGCATCGTCAAGCTGGTGTTTGGACGAATTGGTGGATATCTTAAAGCGCAAAAAAGCTATGAAACAGATAGTAATGACCGTCTTCTATGGAGTGGAGCCATTTGGGGTACGGAACCAGACCGGAGAATTCGGGATCGCTTTCAATGAAACTTGTGCACGTAAGACGGACGAGGAAAGACAAAAATGGAGCAAAGCTTTGAACGAAGTGGCCAATATTGCTGGAGAAGACTTCTTAAGATGTGATAATGAAGCCAAAAGGATAGAGAAGATCGCCAGAGATGTTTCAAATAAACTGAATGCTACACCTTGTAGGGATTTTGACGGCATGGTGGGACTTGAAGCTCATTTGACAGAAATGGAGTCTTTGCTAGATTTAGATTATGATGGAGTTAAGATGGTTGGAATCTCTGGTCCTGCAGGGATTGGTAAGACAACCATAGCCAAAGCTCTGCAGAGTCGATTCTCTAATAGGTTTCAGCTTACTTGTTTTGTCGACAATCTAAGGGGAAGCTATCTTAGTGGTCTAGATGAGTTGCGTTTACAAGAACAATTTCTTTCAAATGTTTTGAACCAAGATGGTATTAGGATAAACCATTCAGGTGTGATAGAAGAAAGGCTATGCAAGCTGAGAGTGCTCATCATTCTTGATGATGTGGACCATATAAAGCAATTAGAGGCGTTGGCAAATAAAACTACATGGTTTGGTCCAAGAAGCAGGATCGTAGTTACCACAGAAAACAAAGAGCTTCTGCAGCAAGAATGGTATCGATGA


Protein sequences

Name Description Sequence
At1g63870/T12P18_11 At1g63870/T12P18_11 [Arabidopsis thaliana].

MSLLASSSSCNYKYIVFPSFHGPDVRKTLLSHMRKQFDFNGITMFDDQGIERSEEIAPSLKKAIKESRISIVILSKKYASSSWCLDELVDILKRKKAMKQIVMTVFYGVEPFGVRNQTGEFGIAFNETCARKTDEERQKWSKALNEVANIAGEDFLRCDNEAKRIEKIARDVSNKLNATPCRDFDGMVGLEAHLTEMESLLDLDYDGVKMVGISGPAGIGKTTIAKALQSRFSNRFQLTCFVDNLRGSYLSGLDELRLQEQFLSNVLNQDGIRINHSGVIEERLCKLRVLIILDDVDHIKQLEALANKTTWFGPRSRIVVTTENKELLQQEWYR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SLLASSSSCNYKYIVFPSFHGPDVRKTLLSHMRKQFDFNGITMFDDQGIERSEEIAPSLKKAIKESRISIVILSKKYASSSWCLDELVDILKRKKAMKQIVMTVFYGVEPFGVRNQTGEFGIAFNETCARKTDEERQKWSKALNEVANIAGE

Gene3D: G3DSA:3.40.50.10140
11-149 G3DSA:3.40.50.10140

NYKYIVFPSFHGPDVRKTLLSHMRKQFDFNGITMFDDQGIERSEEIAPSLKKAIKESRISIVILSKKYASSSWCLDELVDILKRKKAMKQIVMTVFYGVEPFGVRNQTGEFGIAFNETCARKTDEERQKWSKALNEVAN

ProfileScan: PS50104
IPR000157
12-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

YKYIVFPSFHGPDVRKTLLSHMRKQFDFNGITMFDDQGIERSEEIAPSLKKAIKESRISIVILSKKYASSSWCLDELVDILKRKKAMKQIVMTVFYGVEPFGVRNQTGEFGIAFNETCARKTDEERQKWSKALNEVANI

HMMSmart: SM00255
IPR000157
13-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYIVFPSFHGPDVRKTLLSHMRKQFDFNGITMFDDQGIERSEEIAPSLKKAIKESRISIVILSKKYASSSWCLDELVDILKRKKAMKQIVMTVFYGVEPFGVRNQTGEFGIAFNETCARKTDEERQKWSKALNEVANI

HMMPfam: PF01582
IPR000157
16-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGPDVRKTLLSHMRKQFDFNGITMFDDQGIERSEEIAPSLKKAIKESRISIVILSKKYASSSWCLDELVDILKRKKAMKQIVMTVFYGVEPFGVRNQTGEFGIAFNETCARKTDEERQKWSKALN

HMMPanther: PTHR23155
24-320 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKTLLSHMRKQFDFNGITMFDDQGIERSEEIAPSLKKAIKESRISIVILSKKYASSSWCLDELVDILKRKKAMKQIVMTVFYGVEPFGVRNQTGEFGIAFNETCARKTDEERQKWSKALNEVANIAGEDFLRCDNEAKRIEKIARDVSNKLNATPCRDFDGMVGLEAHLTEMESLLDLDYDGVKMVGISGPAGIGKTTIAKALQSRFSNRFQLTCFVDNLRGSYLSGLDELRLQEQFLSNVLNQDGIRINHSGVIEERLCKLRVLIILDDVDHIKQLEALANKTTWFGPRSRIVV

HMMPanther: PTHR23155:SF298
24-320 PTHR23155:SF298

DVRKTLLSHMRKQFDFNGITMFDDQGIERSEEIAPSLKKAIKESRISIVILSKKYASSSWCLDELVDILKRKKAMKQIVMTVFYGVEPFGVRNQTGEFGIAFNETCARKTDEERQKWSKALNEVANIAGEDFLRCDNEAKRIEKIARDVSNKLNATPCRDFDGMVGLEAHLTEMESLLDLDYDGVKMVGISGPAGIGKTTIAKALQSRFSNRFQLTCFVDNLRGSYLSGLDELRLQEQFLSNVLNQDGIRINHSGVIEERLCKLRVLIILDDVDHIKQLEALANKTTWFGPRSRIVV

Gene3D: G3DSA:3.40.50.300
160-222 G3DSA:3.40.50.300

NEAKRIEKIARDVSNKLNATPCRDFDGMVGLEAHLTEMESLLDLDYDGVKMVGISGPAGIGKT

superfamily: SSF52540
170-330 SSF52540

RDVSNKLNATPCRDFDGMVGLEAHLTEMESLLDLDYDGVKMVGISGPAGIGKTTIAKALQSRFSNRFQLTCFVDNLRGSYLSGLDELRLQEQFLSNVLNQDGIRINHSGVIEERLCKLRVLIILDDVDHIKQLEALANKTTWFGPRSRIVVTTENKELLQQ

HMMPfam: PF00931
IPR002182
192-328 NB-ARC,NBS
NB-ARC

AHLTEMESLLDLDYDGVKMVGISGPAGIGKTTIAKALQSRFSNRFQLTCFVDNLRGSYLSGLDELRLQEQFLSNVLNQDGIRINHSGVIEERLCKLRVLIILDDVDHIKQLEALANKTTWFGPRSRIVVTTENKELL

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

MVGISGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
223-329 G3DSA:3.40.50.300

TIAKALQSRFSNRFQLTCFVDNLRGSYLSGLDELRLQEQFLSNVLNQDGIRINHSGVIEERLCKLRVLIILDDVDHIKQLEALANKTTWFGPRSRIVVTTENKELLQ

FPrintScan: PR00364
IPR000767
283-297 DISEASERSIST
Disease resistance protein

RLCKLRVLIILDDVD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox