PRGDB00050891 (LhirPtoF)

From PRG Wiki
Jump to: navigation, search
LhirPtoF
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13021860 (AF318491)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum habrochaites

Comment?

Lycopersicon hirsutum Pto-like protein kinase F (LhirPtoF) mRNA, complete cds.

DNA Sequence

ATGGGAAGCAAGTATTCCAAGGCAACAAATTCCATAAGTGATGCTTCAAACTCTTTTGAAAGTTATCGATTTCCTTTAGTAGATTTGGAGGAAGCAACCAACAATTTTGATGACAAGTTTGTCATTGGAGAGAGTGGATTTGGGAAGGTTTACAGGGGTGTTTTGCGTGATGGAACAAAGGTCGCCCTGAAAAGGCATAATCGTGACTCCCGAGAAAGTATTGAAGAGTTCGAAACAGAAATTGAGATACTCCCACGCCGTAGCCATCCGCATCTGGTTTCATTGATAGGATACTGTGATGATAGAAATGAGATGATTCTAATTTATGACTACATGGAGAATGGGAACCTCAAGAGCCATTTGACTGGCTCAGATCTACCTTCCATGAGCTGGGAGCAGAGGCTGGAGATATGCATAGGGGCAGCCAGAGGTCTACTCTACCTTCATACTAACGGAGTTATACATCGTGATGTCAAGTCTACAAACATATTGCTTGATGAGAATTTTGTGCCAAAAATTACTGATTTTGGACTATCCAAGAAAGGGCCTCAGCTTTATCAAACCCATGTTAGCACAAACGTGAAAGGAACTTTCGGCTACATGGACCCTGAATATGTTATACGGCAAAAGCTGACAGAAAAATCTGATGTTTATTCTTTCGGAGTTGTTTTATTTGAAGTTTTTTGTGCTAGGTCTACCATAGATCCATATCTTCGAAGGGAGATAGTTACTTTAGCTGAATGGGCAGTGAAGTCGCATAATAATGGACAGTTGGAACAAATCGTAGATCCCAATCTTGCAGCTAAAATAAGACCAGAGTCCCTCAGGAAGTTTGGAGAAACAGCGGTAAAATGTCTGGCTTTGTCTGGTAAAGATAGGCCATCAATGGGTGATGTGTTGTGGAAACTGGAGTATGCACTTTGTCTCCAAGAGTCTGTTATTTAA


Protein sequences

Name Description Sequence
Pto-like protein kinase F Pto-like protein kinase F [Lycopersicon hirsutum].

MGSKYSKATNSISDASNSFESYRFPLVDLEEATNNFDDKFVIGESGFGKVYRGVLRDGTKVALKRHNRDSRESIEEFETEIEILPRRSHPHLVSLIGYCDDRNEMILIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLLYLHTNGVIHRDVKSTNILLDENFVPKITDFGLSKKGPQLYQTHVSTNVKGTFGYMDPEYVIRQKLTEKSDVYSFGVVLFEVFCARSTIDPYLRREIVTLAEWAVKSHNNGQLEQIVDPNLAAKIRPESLRKFGETAVKCLALSGKDRPSMGDVLWKLEYALCLQESVI

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
6-311 Kinase_like
Protein kinase-like domain

SKATNSISDASNSFESYRFPLVDLEEATNNFDDKFVIGESGFGKVYRGVLRDGTKVALKRHNRDSRESIEEFETEIEILPRRSHPHLVSLIGYCDDRNEMILIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLLYLHTNGVIHRDVKSTNILLDENFVPKITDFGLSKKGPQLYQTHVSTNVKGTFGYMDPEYVIRQKLTEKSDVYSFGVVLFEVFCARSTIDPYLRREIVTLAEWAVKSHNNGQLEQIVDPNLAAKIRPESLRKFGETAVKCLALSGKDRPSMGDVLWKLEYALCLQE

HMMPanther: PTHR24420
20-311 PTHR24420,FAMILY NOT NAMED

ESYRFPLVDLEEATNNFDDKFVIGESGFGKVYRGVLRDGTKVALKRHNRDSRESIEEFETEIEILPRRSHPHLVSLIGYCDDRNEMILIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLLYLHTNGVIHRDVKSTNILLDENFVPKITDFGLSKKGPQLYQTHVSTNVKGTFGYMDPEYVIRQKLTEKSDVYSFGVVLFEVFCARSTIDPYLRREIVTLAEWAVKSHNNGQLEQIVDPNLAAKIRPESLRKFGETAVKCLALSGKDRPSMGDVLWKLEYALCLQE

HMMPanther: PTHR24420:SF785
20-311 PTHR24420:SF785

ESYRFPLVDLEEATNNFDDKFVIGESGFGKVYRGVLRDGTKVALKRHNRDSRESIEEFETEIEILPRRSHPHLVSLIGYCDDRNEMILIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLLYLHTNGVIHRDVKSTNILLDENFVPKITDFGLSKKGPQLYQTHVSTNVKGTFGYMDPEYVIRQKLTEKSDVYSFGVVLFEVFCARSTIDPYLRREIVTLAEWAVKSHNNGQLEQIVDPNLAAKIRPESLRKFGETAVKCLALSGKDRPSMGDVLWKLEYALCLQE

Gene3D: G3DSA:3.30.200.20
23-98 G3DSA:3.30.200.20

RFPLVDLEEATNNFDDKFVIGESGFGKVYRGVLRDGTKVALKRHNRDSRESIEEFETEIEILPRRSHPHLVSLIGY

ProfileScan: PS50011
IPR000719
36-306 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDDKFVIGESGFGKVYRGVLRDGTKVALKRHNRDSRESIEEFETEIEILPRRSHPHLVSLIGYCDDRNEMILIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLLYLHTNGVIHRDVKSTNILLDENFVPKITDFGLSKKGPQLYQTHVSTNVKGTFGYMDPEYVIRQKLTEKSDVYSFGVVLFEVFCARSTIDPYLRREIVTLAEWAVKSHNNGQLEQIVDPNLAAKIRPESLRKFGETAVKCLALSGKDRPSMGDVLWKLEYA

HMMPfam: PF07714
IPR001245
41-301 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

VIGESGFGKVYRGVLRDGTKVALKRHNRDSRESIEEFETEIEILPRRSHPHLVSLIGYCDDRNEMILIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLLYLHTNGVIHRDVKSTNILLDENFVPKITDFGLSKKGPQLYQTHVSTNVKGTFGYMDPEYVIRQKLTEKSDVYSFGVVLFEVFCARSTIDPYLRREIVTLAEWAVKSHNNGQLEQIVDPNLAAKIRPESLRKFGETAVKCLALSGKDRPSMGDVLW

Gene3D: G3DSA:1.10.510.10
99-300 G3DSA:1.10.510.10

CDDRNEMILIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLLYLHTNGVIHRDVKSTNILLDENFVPKITDFGLSKKGPQLYQTHVSTNVKGTFGYMDPEYVIRQKLTEKSDVYSFGVVLFEVFCARSTIDPYLRREIVTLAEWAVKSHNNGQLEQIVDPNLAAKIRPESLRKFGETAVKCLALSGKDRPSMGDVL

FPrintScan: PR00109
IPR001245
109-122 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

YDYMENGNLKSHLT

FPrintScan: PR00109
IPR001245
147-165 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

YLHTNGVIHRDVKSTNILL

PatternScan: PS00108
IPR008271
153-165 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSTNILL

FPrintScan: PR00109
IPR001245
215-237 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

SDVYSFGVVLFEVFCARSTIDPY


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox