PRGDB00050892 (LhirPtoE)

From PRG Wiki
Jump to: navigation, search
LhirPtoE
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13021857 (AF318490)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum habrochaites

Comment?

Lycopersicon hirsutum Pto-like protein kinase E (LhirPtoE) mRNA, complete cds.

DNA Sequence

ATGGGAAGCAAGTATTCCAAGGCAACAAATTCCATAAATGATGCTTTAAGCTCGAGTTATCTCGTTCCTTTTGAAAGTTATCGAGTTCCTTTAGTAGATTTGGAGGAAGCAACTAATAATTTTGATGACAAGTTTTTCATTGGAGCTGGTGTCTTTGGGAAGGTTTACAAGGGTGTTTTGCGTGATGGAACAAAGGTTGCCCTGAAAAGGCGTAAACCTGAGTCCTCACAAGGTATTGAAGAGTTCGAAACAGAAATTGAGATTCTCTCATTTTGCAGCCATCCGCATCTGGTTTCATTGATAGGATTCTGTGATGAAAGAAATGAGATGATTCTAATTTATAAATACATGGAGAATGGGAACCTCAAGAGTCATTTGTATGGATCAGATCTACCTTCCATGAGCTGGGAGCAGAGGCTGGAGATATGCATAGGGGCAGCCAGAGGGCTATACTACCTTCATACTAGAGCAGTTATACATCGTGATGTCAAGTCTATAAACATATTGCTTGATGAGAATTTTGTGCCAAAAATTACTGATTTTGGAATATCCAAGAAAGGGACTGAGCTTGATCAAACCCATCTTAGCACAGTAGTGCAAGGAACTCTCGGCTACCTTGACCCTGAATATTTTATAAAGGGACGACTCACAGAAAAATCTGATGTTTATTCTTTCGGTGTTGTTTTATTCGAAGTTCTTTGTGCTAGGTCTGCCATAGTTCAATCTCTTCCAAGGGAGATGGTTAATTTAGCTGAATGGGCAGTGGAGTCGCATAATAATGGACAGTTGGAACAAATCATAGATCCCAATCTTGCAGATAAAATAACACCAGAGTCCCTCAGGAAGTTTGGAGAAACAGCGGTAAAATGCTTAGCTTTGTCTAGTGAAGATAGGCCATCAATGGGTGATGTGTTGTGGAAACTGGAGTATGCACTTCGTCTCCAAGAGTCTGTTATTTAA


Protein sequences

Name Description Sequence
Pto-like protein kinase E Pto-like protein kinase E [Lycopersicon hirsutum].

MGSKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDDKFFIGAGVFGKVYKGVLRDGTKVALKRRKPESSQGIEEFETEIEILSFCSHPHLVSLIGFCDERNEMILIYKYMENGNLKSHLYGSDLPSMSWEQRLEICIGAARGLYYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVQGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIIDPNLADKITPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
13-317 Kinase_like
Protein kinase-like domain

NDALSSSYLVPFESYRVPLVDLEEATNNFDDKFFIGAGVFGKVYKGVLRDGTKVALKRRKPESSQGIEEFETEIEILSFCSHPHLVSLIGFCDERNEMILIYKYMENGNLKSHLYGSDLPSMSWEQRLEICIGAARGLYYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVQGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIIDPNLADKITPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQES

HMMPanther: PTHR24420
25-316 PTHR24420,FAMILY NOT NAMED

ESYRVPLVDLEEATNNFDDKFFIGAGVFGKVYKGVLRDGTKVALKRRKPESSQGIEEFETEIEILSFCSHPHLVSLIGFCDERNEMILIYKYMENGNLKSHLYGSDLPSMSWEQRLEICIGAARGLYYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVQGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIIDPNLADKITPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQE

HMMPanther: PTHR24420:SF785
25-316 PTHR24420:SF785

ESYRVPLVDLEEATNNFDDKFFIGAGVFGKVYKGVLRDGTKVALKRRKPESSQGIEEFETEIEILSFCSHPHLVSLIGFCDERNEMILIYKYMENGNLKSHLYGSDLPSMSWEQRLEICIGAARGLYYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVQGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIIDPNLADKITPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQE

Gene3D: G3DSA:3.30.200.20
30-117 G3DSA:3.30.200.20

PLVDLEEATNNFDDKFFIGAGVFGKVYKGVLRDGTKVALKRRKPESSQGIEEFETEIEILSFCSHPHLVSLIGFCDERNEMILIYKYM

ProfileScan: PS50011
IPR000719
41-311 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDDKFFIGAGVFGKVYKGVLRDGTKVALKRRKPESSQGIEEFETEIEILSFCSHPHLVSLIGFCDERNEMILIYKYMENGNLKSHLYGSDLPSMSWEQRLEICIGAARGLYYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVQGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIIDPNLADKITPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYA

HMMPfam: PF07714
IPR001245
47-305 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

IGAGVFGKVYKGVLRDGTKVALKRRKPESSQGIEEFETEIEILSFCSHPHLVSLIGFCDERNEMILIYKYMENGNLKSHLYGSDLPSMSWEQRLEICIGAARGLYYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVQGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIIDPNLADKITPESLRKFGETAVKCLALSSEDRPSMGDVL

PatternScan: PS00107
IPR017441
47-69 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGAGVFGKVYKGVLRDGTKVALK

Gene3D: G3DSA:1.10.510.10
119-307 G3DSA:1.10.510.10

NGNLKSHLYGSDLPSMSWEQRLEICIGAARGLYYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVQGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIIDPNLADKITPESLRKFGETAVKCLALSSEDRPSMGDVLWK

PatternScan: PS00108
IPR008271
158-170 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSINILL


List of References

B K Riely, G B Martin
Ancient origin of pathogen recognition specificity conferred by the tomato disease resistance gene Pto.
Proc. Natl. Acad. Sci. U.S.A.: 2001, 98(4);2059-64
PubMed:11172075 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox