PRGDB00050893 (Rb'2)

From PRG Wiki
Jump to: navigation, search
Rb'2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 1809260 (U59315)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium serine/threonine protein kinase Pto (Pto) gene, Rb'1, Ra, and Rb'2 pseudogenes, complete cds.

DNA Sequence

ATGGGAAGCAAGTATTCTAAGGCAACAAATTCCATAAATGATGCTTTAAGCTCGAGTTATCTCGTTCCTTTTGAAAGTTATCGAGTTCCTTTAGTAGATTTGGAGGAAGCAACTAATAATTTTGATCACAAGTTTTTAATTGGACATGGTGTCTTTGGGAAGGTTTACAAGGGTGTTTTGCGTGATGGAGCAAAGGTGGCCCTGAAAAGGCGTACACCTGAGTCCTCACAAGGTATTGAAGAGTTCGAAACAGAAATTGAGACTCTCTCATTTTGCAGACATCCGCATCTGGTTTCATTGATAGGATTCTGTGATGAAAGAAATGAGATGATTCTAATTTATAAATACATGGAGAATGGGAACCTCAAGAGACATTTGTATGGATCAGATCTACCCACAATGAGCATGAGCTGGGAGCAGAGGCTGGAGATATGCATAGGGGCAGCCAGAGGTCTACACTACCTTCATACTAGAGCAATTATACATCGTGATGTCAAGTCTATAAACATATTGCTTGATGAGAATTTTGTGCCAAAAATTACTGATTTTGGAATATCCAAGAAAGGGACTGAGCTTGATCAAACCCATCTTAGCACAGTAGTGAAAGGAACTCTCGGCTACATTGACCCTGAATATTTTATAAAGGGACGACTCACTGAAAAATCTGATGTTTATTCTTTCGGTGTTGTTTTATTCGAAGTTCTTTGTGCTAGGTCTGCCATAGTTCAATCTCTTCCAAGGGAGATGGTTAATTTAGCTGAATGGGCAGTGGAGTCGCATAATAATGGACAGTTGGAACAAATCGTAGATCCCAATCTTGCAGATAAAATAAGACCAGAGTCCCTCAGGAAGTTTGGAGATACAGCGGTAAAATGCTTAGCTTTGTCTAGTGAAGATAGGCCATCAATGGGTGATGTGTTGTGGAAACTGGAGTATGCACTTCGTCTCCAAGAGTCTGTTATTTAA


Protein sequences

Name Description Sequence
serine/threonine protein kinase Pto serine/threonine protein kinase Pto [Lycopersicon pimpinellifolium].

MGSKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
13-319 Kinase_like
Protein kinase-like domain

NDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQES

HMMPanther: PTHR24420
25-318 PTHR24420,FAMILY NOT NAMED

ESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQE

HMMPanther: PTHR24420:SF785
25-318 PTHR24420:SF785

ESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQE

Gene3D: G3DSA:3.30.200.20
30-117 G3DSA:3.30.200.20

PLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYM

ProfileScan: PS50011
IPR000719
41-313 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYA

HMMPfam: PF07714
IPR001245
46-307 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

LIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVL

PatternScan: PS00107
IPR017441
47-69 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGHGVFGKVYKGVLRDGAKVALK

Gene3D: G3DSA:1.10.510.10
119-309 G3DSA:1.10.510.10

NGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWK

PatternScan: PS00108
IPR008271
160-172 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSINILL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox