PRGDB00050894 (Sb'2)

From PRG Wiki
Jump to: navigation, search
Sb'2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 1809256 (U59316)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum serine/threonine protein kinase pto (pto) gene, Sb'1, Sa, and Sb'2 pseudogenes, complete cds.

DNA Sequence

ATGGGAAGCAAGTATTCCAAGGCAACAAATTCCATAAGTGATGCTTCAAACTCTTTTGAAAGTTATCGATTTCCTTTAGAAGATTTGGAGGAAGCAACCAACAATTTTGATGACAAGTTTTTCATTGGAGAGGGTGCATTTGGGAAGGTTTACAAGGGTGTTTTGCGTGATGGAACAAAGGTCGCCCTGAAAAGGCAAAATCGTGACTCCCGGCAAGGTATTGAAGAGTTCGGAACAGAAATTGGGATACTCTCACGCCGTAGCCATCCGCATCTGGTTTCATTGATAGGATACTGTGATGAAAGAAATGAGATGGTTCTAATTTATGACTACATGGAGAATGGGAACCTCAAGAGCCATTTGACTGGCTCAGATCTACCCTCCATGAGCTGGGAGCAGAGGCTGGAGATATGCATAGGGGCAGCCAGAGGTCTACACTACCTTCATACTAACGGAGTTATGCATCGTGATGTCAAATCTTCAAACATATTGCTTGATGAGAATTTTGTGCCAAAAATTACTGACTTTGGACTATCCAAGACAAGGCCTCAGCTTTATCAAACCACAGACGTGAAAGGAACTTTCGGCTACATTGACCCTGAATATTTTATAAAGGGACGACTCACTGAAAAATCTGATGTTTATTCTTTCGGTGTTGTTTTATTTGAAGTTCTTTGTGCTAGGTCTGCCATGGTTCAATCTCTTCCAAGGGAGATGGTTAATTTAGCTGAATGGGCAGTGGAGTCGCATAATAATGGACAGTTGGAACAAATCGTAGATCCCAATCTTGCAGATAAAATAAGACCAGAGTCCCTCAGGAAGTTTGGAGAAACAGCGGTAAAATGCTTAGCTTTGTCTAGTGAAGATAGGCCATCAATGGGTGATGTGTTGTGGAAACTGGAGTATGCACTTCGTCTCCAAGAGTCTGTTATTTAA


Protein sequences

Name Description Sequence
serine/threonine protein kinase Pto serine/threonine protein kinase Pto [Lycopersicon esculentum].

MGSKYSKATNSISDASNSFESYRFPLEDLEEATNNFDDKFFIGEGAFGKVYKGVLRDGTKVALKRQNRDSRQGIEEFGTEIGILSRRSHPHLVSLIGYCDERNEMVLIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLHYLHTNGVMHRDVKSSNILLDENFVPKITDFGLSKTRPQLYQTTDVKGTFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAMVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
6-308 Kinase_like
Protein kinase-like domain

SKATNSISDASNSFESYRFPLEDLEEATNNFDDKFFIGEGAFGKVYKGVLRDGTKVALKRQNRDSRQGIEEFGTEIGILSRRSHPHLVSLIGYCDERNEMVLIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLHYLHTNGVMHRDVKSSNILLDENFVPKITDFGLSKTRPQLYQTTDVKGTFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAMVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQE

HMMPanther: PTHR24420
20-308 PTHR24420,FAMILY NOT NAMED

ESYRFPLEDLEEATNNFDDKFFIGEGAFGKVYKGVLRDGTKVALKRQNRDSRQGIEEFGTEIGILSRRSHPHLVSLIGYCDERNEMVLIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLHYLHTNGVMHRDVKSSNILLDENFVPKITDFGLSKTRPQLYQTTDVKGTFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAMVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQE

HMMPanther: PTHR24420:SF785
20-308 PTHR24420:SF785

ESYRFPLEDLEEATNNFDDKFFIGEGAFGKVYKGVLRDGTKVALKRQNRDSRQGIEEFGTEIGILSRRSHPHLVSLIGYCDERNEMVLIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLHYLHTNGVMHRDVKSSNILLDENFVPKITDFGLSKTRPQLYQTTDVKGTFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAMVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQE

Gene3D: G3DSA:3.30.200.20
22-104 G3DSA:3.30.200.20

YRFPLEDLEEATNNFDDKFFIGEGAFGKVYKGVLRDGTKVALKRQNRDSRQGIEEFGTEIGILSRRSHPHLVSLIGYCDERNE

ProfileScan: PS50011
IPR000719
36-303 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDDKFFIGEGAFGKVYKGVLRDGTKVALKRQNRDSRQGIEEFGTEIGILSRRSHPHLVSLIGYCDERNEMVLIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLHYLHTNGVMHRDVKSSNILLDENFVPKITDFGLSKTRPQLYQTTDVKGTFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAMVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYA

HMMPfam: PF07714
IPR001245
42-297 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

IGEGAFGKVYKGVLRDGTKVALKRQNRDSRQGIEEFGTEIGILSRRSHPHLVSLIGYCDERNEMVLIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLHYLHTNGVMHRDVKSSNILLDENFVPKITDFGLSKTRPQLYQTTDVKGTFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAMVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVL

PatternScan: PS00107
IPR017441
42-64 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGAFGKVYKGVLRDGTKVALK

Gene3D: G3DSA:1.10.510.10
105-297 G3DSA:1.10.510.10

MVLIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLHYLHTNGVMHRDVKSSNILLDENFVPKITDFGLSKTRPQLYQTTDVKGTFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAMVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVL

FPrintScan: PR00109
IPR001245
109-122 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

YDYMENGNLKSHLT

FPrintScan: PR00109
IPR001245
147-165 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

YLHTNGVMHRDVKSSNILL

PatternScan: PS00108
IPR008271
153-165 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VMHRDVKSSNILL

FPrintScan: PR00109
IPR001245
212-234 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

SDVYSFGVVLFEVLCARSAMVQS


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox