PRGDB00050896 (putative Pto-like serine/threonine kinase)

From PRG Wiki
Jump to: navigation, search
putative Pto-like serine/threonine kinase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 15054786 (AF288568)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum vernei

Comment?

Solanum vernei vrnBB1 putative Pto-like serine/threonine kinase gene, partial cds.

DNA Sequence

TTTAAACTCGAGTTATCGCGTTCCTTTTGAAAGTTATCGAGTTCCTTTTGTAGATTTGCAGGAAGCAACTAACAACTTCGATGAGAAGTTTCACATTGGATTGGGTGGCTTTGGGAAAGTTTACAGGGGTGTTTTGCGTGATGGAACAAAGGTGGCCCTGAAGAGGTGTAAGCGTGAGTCCTCGCAAGGTATTGAAGAGTTCCAAACAGAAATTGAGATTCTCTCTTTTTGCAGCCATCCGCATTTGATTTCATTGATAGGATACTGTGATGAAAGAAATGAGATGATTCTAGTTTATGACTACATTGAGAATGGGAACCTCAGGAGCCATTTGTATGGCTTAGATCTACCCACTATGAGCTGGGAGCAGAGGCTGGAGATATGCATCGGGACAGCCAGAGGTCTGCATTACCTTCATAGTAGCGCAGTTATACATCGTGATGTCAAGTCTATAAACATATTGCTTGATGAGAATTTTGTGGCAAAAATTACTGATTTTGGACTCTCCAAGAAAGGGACTGAGCTTGATGAAACCCATCTTAGCACCCTTGTGCAAGGAACTATAGGCTACCTTGACCCTGAATATTTTATAAGGGGACAACTGACAGAAAAAT


Protein sequences

Name Description Sequence
putative Pto-like serine/threonine kinase putative Pto-like serine/threonine kinase [Solanum vernei].

LNSSYRVPFESYRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFQTEIEILSFCSHPHLISLIGYCDERNEMILVYDYIENGNLRSHLYGLDLPTMSWEQRLEICIGTARGLHYLHSSAVIHRDVKSINILLDENFVAKITDFGLSKKGTELDETHLSTLVQGTIGYLDPEYFIRGQLTEK

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-204 Kinase_like
Protein kinase-like domain

LNSSYRVPFESYRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFQTEIEILSFCSHPHLISLIGYCDERNEMILVYDYIENGNLRSHLYGLDLPTMSWEQRLEICIGTARGLHYLHSSAVIHRDVKSINILLDENFVAKITDFGLSKKGTELDETHLSTLVQGTIGYLDPEYFIRGQLTEK

HMMPanther: PTHR24420
10-204 PTHR24420,FAMILY NOT NAMED

ESYRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFQTEIEILSFCSHPHLISLIGYCDERNEMILVYDYIENGNLRSHLYGLDLPTMSWEQRLEICIGTARGLHYLHSSAVIHRDVKSINILLDENFVAKITDFGLSKKGTELDETHLSTLVQGTIGYLDPEYFIRGQLTEK

HMMPanther: PTHR24420:SF785
10-204 PTHR24420:SF785

ESYRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFQTEIEILSFCSHPHLISLIGYCDERNEMILVYDYIENGNLRSHLYGLDLPTMSWEQRLEICIGTARGLHYLHSSAVIHRDVKSINILLDENFVAKITDFGLSKKGTELDETHLSTLVQGTIGYLDPEYFIRGQLTEK

Gene3D: G3DSA:3.30.200.20
14-87 G3DSA:3.30.200.20

VPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFQTEIEILSFCSHPHLISLIG

ProfileScan: PS50011
IPR000719
26-204 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFQTEIEILSFCSHPHLISLIGYCDERNEMILVYDYIENGNLRSHLYGLDLPTMSWEQRLEICIGTARGLHYLHSSAVIHRDVKSINILLDENFVAKITDFGLSKKGTELDETHLSTLVQGTIGYLDPEYFIRGQLTEK

HMMPfam: PF00069
IPR000719
31-197 Pkinase,Ser-thr
Protein kinase, catalytic domain

HIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFQTEIEILSFCSHPHLISLIGYCDERNEMILVYDYIENGNLRSHLYGLDLPTMSWEQRLEICIGTARGLHYLHSSAVIHRDVKSINILLDENFVAKITDFGLSKKGTELDETHLSTLVQGTIGYLDPEYFI

PatternScan: PS00107
IPR017441
32-54 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGLGGFGKVYRGVLRDGTKVALK

Gene3D: G3DSA:1.10.510.10
88-203 G3DSA:1.10.510.10

YCDERNEMILVYDYIENGNLRSHLYGLDLPTMSWEQRLEICIGTARGLHYLHSSAVIHRDVKSINILLDENFVAKITDFGLSKKGTELDETHLSTLVQGTIGYLDPEYFIRGQLTE

PatternScan: PS00108
IPR008271
143-155 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSINILL


List of References

V G Vleeshouwers, A Martens, W van Dooijeweert, L T Colon, F Govers, S Kamoun
Ancient diversification of the Pto kinase family preceded speciation in Solanum.
Mol. Plant Microbe Interact.: 2001, 14(8);996-1005
PubMed:11497472 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox