PRGDB00050922 (putative Pto-like serine/threonine kinase)

From PRG Wiki
Jump to: navigation, search
putative Pto-like serine/threonine kinase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 15054734 (AF288542)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum berthaultii

Comment?

Solanum berthaultii berDF1 putative Pto-like serine/threonine kinase gene, partial cds.

DNA Sequence

CAAGTATGAGCTGGGAGCAGAGGCTGGAGATATGCATCGGGGCAGCCAGAGATCTTTACTACCTTCATAACAACGCAGTTATACATCGTGATGTCAAGTCTACAAACATATTGCTTGATGAGAATTTTGTGTCAAAAATTACTGATTTTGGAATATCCAAGACAATACCTGAGCTTGATCAAACCCACTTTAGCACAACGGTGGAAGGAAGTATAGGCTACATTGACCCTGAATATTTAAGAAGCCTACAGGTGACAAAAAAATCTGATGTTTATTCTTTCGGTGTTGTTTTATTCGAAGTTCTTTGTGCTAGGCCTGCCATAGGTCGTTCACATATGGTTAGTTTAGCTGAATGGGCAGTAGAGACGCAGAAGATGGGACAGTTGGAACAAATTGTAGATCCCACTATTGCAACAAAAATAAGACCAGAGTCCCTCAGGATGTTTGGAGAAACAGCGGTGAAATGCTTAGCTTCGTCTAGTGAAAATAGGCCATCAATGGGTGATGTGCTG


Protein sequences

Name Description Sequence
putative Pto-like serine/threonine kinase putative Pto-like serine/threonine kinase [Solanum berthaultii].

SMSWEQRLEICIGAARDLYYLHNNAVIHRDVKSTNILLDENFVSKITDFGISKTIPELDQTHFSTTVEGSIGYIDPEYLRSLQVTKKSDVYSFGVVLFEVLCARPAIGRSHMVSLAEWAVETQKMGQLEQIVDPTIATKIRPESLRMFGETAVKCLASSSENRPSMGDVL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF785
1-170 PTHR24420:SF785

SMSWEQRLEICIGAARDLYYLHNNAVIHRDVKSTNILLDENFVSKITDFGISKTIPELDQTHFSTTVEGSIGYIDPEYLRSLQVTKKSDVYSFGVVLFEVLCARPAIGRSHMVSLAEWAVETQKMGQLEQIVDPTIATKIRPESLRMFGETAVKCLASSSENRPSMGDVL

ProfileScan: PS50011
IPR000719
1-170 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SMSWEQRLEICIGAARDLYYLHNNAVIHRDVKSTNILLDENFVSKITDFGISKTIPELDQTHFSTTVEGSIGYIDPEYLRSLQVTKKSDVYSFGVVLFEVLCARPAIGRSHMVSLAEWAVETQKMGQLEQIVDPTIATKIRPESLRMFGETAVKCLASSSENRPSMGDVL

HMMPanther: PTHR24420
1-170 PTHR24420,FAMILY NOT NAMED

SMSWEQRLEICIGAARDLYYLHNNAVIHRDVKSTNILLDENFVSKITDFGISKTIPELDQTHFSTTVEGSIGYIDPEYLRSLQVTKKSDVYSFGVVLFEVLCARPAIGRSHMVSLAEWAVETQKMGQLEQIVDPTIATKIRPESLRMFGETAVKCLASSSENRPSMGDVL

HMMPfam: PF00069
IPR000719
2-169 Pkinase,Ser-thr
Protein kinase, catalytic domain

MSWEQRLEICIGAARDLYYLHNNAVIHRDVKSTNILLDENFVSKITDFGISKTIPELDQTHFSTTVEGSIGYIDPEYLRSLQVTKKSDVYSFGVVLFEVLCARPAIGRSHMVSLAEWAVETQKMGQLEQIVDPTIATKIRPESLRMFGETAVKCLASSSENRPSMGDV

Gene3D: G3DSA:1.10.510.10
2-170 G3DSA:1.10.510.10

MSWEQRLEICIGAARDLYYLHNNAVIHRDVKSTNILLDENFVSKITDFGISKTIPELDQTHFSTTVEGSIGYIDPEYLRSLQVTKKSDVYSFGVVLFEVLCARPAIGRSHMVSLAEWAVETQKMGQLEQIVDPTIATKIRPESLRMFGETAVKCLASSSENRPSMGDVL

superfamily: SSF56112
IPR011009
2-170 Kinase_like
Protein kinase-like domain

MSWEQRLEICIGAARDLYYLHNNAVIHRDVKSTNILLDENFVSKITDFGISKTIPELDQTHFSTTVEGSIGYIDPEYLRSLQVTKKSDVYSFGVVLFEVLCARPAIGRSHMVSLAEWAVETQKMGQLEQIVDPTIATKIRPESLRMFGETAVKCLASSSENRPSMGDVL

PatternScan: PS00108
IPR008271
26-38 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSTNILL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox