PRGDB00050931 (At2g17220/T23A1.8)

From PRG Wiki
Jump to: navigation, search
At2g17220/T23A1.8
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 15146243 (AY049263)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At2g17220/T23A1.8 mRNA, complete cds.

DNA Sequence

ATGGGTCTTTGTTGGGGATCTCCATCTGATTCTCCTCCAACAACAACACCTTCCTCTACTGGTAACATCAGTTCAGTAGGGACTTTTAAGTCATCAAACAACACGACGACTACAGGAACATCAAGGGGAAGTAACATATCTAGCAATAGTGGGTTCTCTGTGGCAAGTGGTGAAGATGCTTACCCCGATGGTCAGATACTTCCCATTCCGAATTTGAGGATATTCAGCTTAGCAGAACTTAGAGCTTCAACAAGGAATTTCAGGTCTGAGAATGTTCTTGGAGAGGGAGGATTTGGGAAAGTCTTTAAAGGCTGGCTTGAAGACAAGACTCCAGGGAAACAAAGCAACGGAACTGTGATTGCTGTTAAGAAACTGAATGCAGAAAGCTTCCAAGGATTCGAAGAATGGCAATGTGAAGTGAATTTTCTTGGGAGGGTTTCTCATCCAAACCTCGTGAAGCTGTTGGGATACTGCTTGGAAGGTGAAGAGTTGCTTCTTGTGTATGAGTATATGCAAAAAGGGAGCTTAGAGAATCATCTCTTCCGAAAGGGGTCTGCCGTTCAGCCACTCTCATGGGAGATAAGGCTTAAGATTGCAATAGGAGCAGCTAAAGGCTTAGCATTCTTACACGCTTCAGAGAAGCAAGTAATTTATCGAGACTTCAAAGCGTCAAACATTCTACTTGATGGGTCATATAACGCAAAGATATCAGATTTTGGATTGGCGAAATTAGGACCTTCCGCTAGTCAATCTCACATCACAACACGGGTTATGGGTACACACGGTTACGCAGCTCCAGAGTATGTTGCTACAGGTCACTTGTATGTAAAGAGCGATGTTTACGGGTTTGGCGTTGTTTTGGCTGAGATCTTAACTGGTTTACATGCGCTTGATCCTACTCGTCCTACCGGGCAACACAATCTAACCGAATGGATCAAACCTCATCTATCCGAAAGAAGAAAGCTAAGAAGCATAATGGACCCTCGTCTAGAAGGAAAATACCCTTTCAAATCTGCTTTCCGAGTAGCTCAACTGGCTCTGAAATGCCTTGGACCCGAACCCAAAAACCGTCCATCGATGAAAGAAGTGGTGGAATCGCTCGAACTCATCGAAGCTGCCAATGAGAAACCGTTAGAACGAAGGACCACTAGAGCTTCCCCATCCATCCGTCAACAACAAGGCCATTATCGCCCGCAACAACTCTCTTCGTTTCGTCCTAGACAAAACGTGTCTCGAGCTCACTAG


Protein sequences

Name Description Sequence
At2g17220/T23A1.8 At2g17220/T23A1.8 [Arabidopsis thaliana].

MGLCWGSPSDSPPTTTPSSTGNISSVGTFKSSNNTTTTGTSRGSNISSNSGFSVASGEDAYPDGQILPIPNLRIFSLAELRASTRNFRSENVLGEGGFGKVFKGWLEDKTPGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYEYMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLDGSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLELIEAANEKPLERRTTRASPSIRQQQGHYRPQQLSSFRPRQNVSRAH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF531
17-392 PTHR24420:SF531

PSSTGNISSVGTFKSSNNTTTTGTSRGSNISSNSGFSVASGEDAYPDGQILPIPNLRIFSLAELRASTRNFRSENVLGEGGFGKVFKGWLEDKTPGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYEYMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLDGSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLELIEAANEKPLERRTTRASPSIRQQ

HMMPanther: PTHR24420
17-392 PTHR24420,FAMILY NOT NAMED

PSSTGNISSVGTFKSSNNTTTTGTSRGSNISSNSGFSVASGEDAYPDGQILPIPNLRIFSLAELRASTRNFRSENVLGEGGFGKVFKGWLEDKTPGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYEYMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLDGSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLELIEAANEKPLERRTTRASPSIRQQ

superfamily: SSF56112
IPR011009
59-390 Kinase_like
Protein kinase-like domain

DAYPDGQILPIPNLRIFSLAELRASTRNFRSENVLGEGGFGKVFKGWLEDKTPGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYEYMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLDGSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLELIEAANEKPLERRTTRASPSIR

Gene3D: G3DSA:3.30.200.20
71-157 G3DSA:3.30.200.20

NLRIFSLAELRASTRNFRSENVLGEGGFGKVFKGWLEDKTPGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGY

ProfileScan: PS50011
IPR000719
87-370 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRSENVLGEGGFGKVFKGWLEDKTPGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYEYMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLDGSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLELI

HMMPfam: PF07714
IPR001245
90-367 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

ENVLGEGGFGKVFKGWLEDKTPGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYEYMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLDGSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESL

PatternScan: PS00107
IPR017441
93-124 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGKVFKGWLEDKTPGKQSNGTVIAVKK

Gene3D: G3DSA:1.10.510.10
158-378 G3DSA:1.10.510.10

CLEGEELLLVYEYMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLDGSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLELIEAANEKPL

PatternScan: PS00108
IPR008271
216-228 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox