PRGDB00050938 (kapp)

From PRG Wiki
Jump to: navigation, search
kapp
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3328363 (AF075603)
Gene Class Unknown
Domain Type Receptor-Like Kinase
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa kinase associated protein phosphatase (kapp) mRNA, complete cds.

DNA Sequence

ATGGCCGCGCCGCCCCTCCCCTTCGTCCTCGCCGCCGCCGCCATAGCCTCCCTCGTCATTCTCGTCCTCGTCGTCTTCGCCTGCCGGCGATGGCGGCGCGCGGTGGTAGCGGCGGCGCCGCAGCCGCCGCCGCGGGCGGCGGCGGATGTCGTCGCCGCATCTCCGGTCCGCAGCCAGAATGAGGATTTAAATAAGCCTCTCCTTGAAATTCTGGATGATCACTCTAGCCAGAGTAACACTTTTCCTGGAAATGTTGTTGGAGAATCTTCAAAAGTTCATACAAGCAGGAGTGATACTTCACCAAGAAGTCATGGAATAAGTGATTCTGGCAGGACTTATCCTGCTGATTCCTGCACTCCGCAAGGAGAAACTCATGTGATCGATGTTACAGATGATACATCTGAAGAGTTCCATTTGGGAAGCACACTGAAGTGTACAAAACAGACAAGTTGGTCAAGGCCTGATAAAAAACACAAAAGATGGGGTTCTGGAGAGGATAATAAGAATGGAAGCATTTCTCTAAAAGATAATACATATCGAAGCAACCTAGACGTAGAGGTCATTGCTGGCCCATCTCACGGAATAAGTTGTTCCCGACAGTCAACTAGTCCTACAATCCCGATAACTCTTGGAAGGGTCCCCCCAAGTGATTTGGTGTTGAAGGACTCTGAGGTGTCAGGGAAACATGCTCGAATAAATTGGAATGCAAAGACATTGAAATGGGAAATTGTGGACATGGGCAGCTTGAATGGGACATTTGTGAACTCTCGGGCAGTTCACCATCCAAATGTTGGGTCCAGGCACTGGGGTGAGCCAGCTGAACTAGCAGATGGTGACATTATAACTCTAGGAACTTCATCAAAACTATCTGTCCAGATCTCACTGCAAAATCAGCGAGTCCCTGCTGGGATTGGTATGGCATCTGATCCAATGGTGGGCCGTCGAAGTGGAAAGAAGCTTGCAATGGAGGATATAAGCTTTTGCCAGTGCCCTCTGCAGGGTGTTGAACAGTTTGGACTCTTTGGAATTTTTGATGGACATGGTGGTGATGGAGCTGCCAGAGCTGTCAGCAAGATTTTTCCAGAAAATGTGGCAACTCTTTTGTCTCACCATGAGACAAAAGAAAAGGTTCTTTCATACTCTGATGCTTCTGACGTTCTTAGATATGCTTTTACTATGACAGAAGCTGCAATCGATCATGAGTATGAGGGGTGCACAGCAACAGTCCTGCTGATTTGGTTTGATCAAAAGAAAGACTGTTTTGCCCAATGTGCTAATCTAGGTGATTCAGCTTGTGTTATGAGTGTCAATGGAAAGATGATTGAAATGACTGAAGATCATCGAGTAGCTAGTGTAACTGAACGAGCTAGGATAGCAAGAGCTGGACAGGCCCTGAAAGCTGGCGAAGTCCGGATTAATGGACTTAATCTCGCCAGGATGTTCGGAGATAAGTTTCTAAAAGAGCAAGATTCACGCTTCAGCTCAGAACCATATGTGAGCCAAGCTGTTCACATTACAAAAGCATGCACAGCTTTTGCAGTTATTGCTAGCGATGGGCTCTGGGATGTTATTAGTACTAAAAGGGCAGTTCAGCTTGTTGTTGAGGGTAGGGAGAGAAACAGTGGTGATAGTGCCTCGGCGGACAAAGTAGCCAATCGTATACTAAGTGAAGCTAGGAATTTGCGAACCAAGGACAATACATCCGTAATATTTGTAGATTTTGACATCTTGAGAACAGACCATTGTATTGCCAAATGA


Protein sequences

Name Description Sequence
kinase associated protein phosphatase kinase associated protein phosphatase [Oryza sativa].

MAAPPLPFVLAAAAIASLVILVLVVFACRRWRRAVVAAAPQPPPRAAADVVAASPVRSQNEDLNKPLLEILDDHSSQSNTFPGNVVGESSKVHTSRSDTSPRSHGISDSGRTYPADSCTPQGETHVIDVTDDTSEEFHLGSTLKCTKQTSWSRPDKKHKRWGSGEDNKNGSISLKDNTYRSNLDVEVIAGPSHGISCSRQSTSPTIPITLGRVPPSDLVLKDSEVSGKHARINWNAKTLKWEIVDMGSLNGTFVNSRAVHHPNVGSRHWGEPAELADGDIITLGTSSKLSVQISLQNQRVPAGIGMASDPMVGRRSGKKLAMEDISFCQCPLQGVEQFGLFGIFDGHGGDGAARAVSKIFPENVATLLSHHETKEKVLSYSDASDVLRYAFTMTEAAIDHEYEGCTATVLLIWFDQKKDCFAQCANLGDSACVMSVNGKMIEMTEDHRVASVTERARIARAGQALKAGEVRINGLNLARMFGDKFLKEQDSRFSSEPYVSQAVHITKACTAFAVIASDGLWDVISTKRAVQLVVEGRERNSGDSASADKVANRILSEARNLRTKDNTSVIFVDFDILRTDHCIAK

Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF016465
IPR016660
1-581 Kap_phosphatase
Kinase associated protein phosphatase

MAAPPLPFVLAAAAIASLVILVLVVFACRRWRRAVVAAAPQPPPRAAADVVAASPVRSQNEDLNKPLLEILDDHSSQSNTFPGNVVGESSKVHTSRSDTSPRSHGISDSGRTYPADSCTPQGETHVIDVTDDTSEEFHLGSTLKCTKQTSWSRPDKKHKRWGSGEDNKNGSISLKDNTYRSNLDVEVIAGPSHGISCSRQSTSPTIPITLGRVPPSDLVLKDSEVSGKHARINWNAKTLKWEIVDMGSLNGTFVNSRAVHHPNVGSRHWGEPAELADGDIITLGTSSKLSVQISLQNQRVPAGIGMASDPMVGRRSGKKLAMEDISFCQCPLQGVEQFGLFGIFDGHGGDGAARAVSKIFPENVATLLSHHETKEKVLSYSDASDVLRYAFTMTEAAIDHEYEGCTATVLLIWFDQKKDCFAQCANLGDSACVMSVNGKMIEMTEDHRVASVTERARIARAGQALKAGEVRINGLNLARMFGDKFLKEQDSRFSSEPYVSQAVHITKACTAFAVIASDGLWDVISTKRAVQLVVEGRERNSGDSASADKVANRILSEARNLRTKDNTSVIFVDFDILRTDH

superfamily: SSF49879
IPR008984
178-298 SMAD_FHA
SMAD/FHA domain

TYRSNLDVEVIAGPSHGISCSRQSTSPTIPITLGRVPPSDLVLKDSEVSGKHARINWNAKTLKWEIVDMGSLNGTFVNSRAVHHPNVGSRHWGEPAELADGDIITLGTSSKLSVQISLQNQ

HMMPanther: PTHR13832
IPR015655
204-576 PP2C
Protein phosphatase 2C

PTIPITLGRVPPSDLVLKDSEVSGKHARINWNAKTLKWEIVDMGSLNGTFVNSRAVHHPNVGSRHWGEPAELADGDIITLGTSSKLSVQISLQNQRVPAGIGMASDPMVGRRSGKKLAMEDISFCQCPLQGVEQFGLFGIFDGHGGDGAARAVSKIFPENVATLLSHHETKEKVLSYSDASDVLRYAFTMTEAAIDHEYEGCTATVLLIWFDQKKDCFAQCANLGDSACVMSVNGKMIEMTEDHRVASVTERARIARAGQALKAGEVRINGLNLARMFGDKFLKEQDSRFSSEPYVSQAVHITKACTAFAVIASDGLWDVISTKRAVQLVVEGRERNSGDSASADKVANRILSEARNLRTKDNTSVIFVDFDI

HMMPanther: PTHR13832:SF10
204-576 PTHR13832:SF10,KINASE ASSOCIATED PROTEIN PHOSPHATASE

PTIPITLGRVPPSDLVLKDSEVSGKHARINWNAKTLKWEIVDMGSLNGTFVNSRAVHHPNVGSRHWGEPAELADGDIITLGTSSKLSVQISLQNQRVPAGIGMASDPMVGRRSGKKLAMEDISFCQCPLQGVEQFGLFGIFDGHGGDGAARAVSKIFPENVATLLSHHETKEKVLSYSDASDVLRYAFTMTEAAIDHEYEGCTATVLLIWFDQKKDCFAQCANLGDSACVMSVNGKMIEMTEDHRVASVTERARIARAGQALKAGEVRINGLNLARMFGDKFLKEQDSRFSSEPYVSQAVHITKACTAFAVIASDGLWDVISTKRAVQLVVEGRERNSGDSASADKVANRILSEARNLRTKDNTSVIFVDFDI

Gene3D: G3DSA:2.60.200.20
IPR000253
205-293 FHA
Forkhead-associated (FHA) domain

TIPITLGRVPPSDLVLKDSEVSGKHARINWNAKTLKWEIVDMGSLNGTFVNSRAVHHPNVGSRHWGEPAELADGDIITLGTSSKLSVQI

HMMSmart: SM00240
IPR000253
207-259 FHA
Forkhead-associated (FHA) domain

PITLGRVPPSDLVLKDSEVSGKHARINWNAKTLKWEIVDMGSLNGTFVNSRAV

HMMPfam: PF00498
IPR000253
208-284 FHA
Forkhead-associated (FHA) domain

ITLGRVPPSDLVLKDSEVSGKHARINWNAKTLKWEIVDMGSLNGTFVNSRAVHHPNVGSRHWGEPAELADGDIITLG

ProfileScan: PS50006
IPR000253
208-259 FHA_DOMAIN
Forkhead-associated (FHA) domain

ITLGRVPPSDLVLKDSEVSGKHARINWNAKTLKWEIVDMGSLNGTFVNSRAV

superfamily: SSF81606
IPR001932
288-575 PP2C-related
Protein phosphatase 2C-like

KLSVQISLQNQRVPAGIGMASDPMVGRRSGKKLAMEDISFCQCPLQGVEQFGLFGIFDGHGGDGAARAVSKIFPENVATLLSHHETKEKVLSYSDASDVLRYAFTMTEAAIDHEYEGCTATVLLIWFDQKKDCFAQCANLGDSACVMSVNGKMIEMTEDHRVASVTERARIARAGQALKAGEVRINGLNLARMFGDKFLKEQDSRFSSEPYVSQAVHITKACTAFAVIASDGLWDVISTKRAVQLVVEGRERNSGDSASADKVANRILSEARNLRTKDNTSVIFVDFD

HMMSmart: SM00332
IPR001932
297-572 PP2Cc
Protein phosphatase 2C-like

NQRVPAGIGMASDPMVGRRSGKKLAMEDISFCQCPLQGVEQFGLFGIFDGHGGDGAARAVSKIFPENVATLLSHHETKEKVLSYSDASDVLRYAFTMTEAAIDHEYEGCTATVLLIWFDQKKDCFAQCANLGDSACVMSVNGKMIEMTEDHRVASVTERARIARAGQALKAGEVRINGLNLARMFGDKFLKEQDSRFSSEPYVSQAVHITKACTAFAVIASDGLWDVISTKRAVQLVVEGRERNSGDSASADKVANRILSEARNLRTKDNTSVIFV

Gene3D: G3DSA:3.60.40.10
IPR001932
314-575 PP2C-related
Protein phosphatase 2C-like

RRSGKKLAMEDISFCQCPLQGVEQFGLFGIFDGHGGDGAARAVSKIFPENVATLLSHHETKEKVLSYSDASDVLRYAFTMTEAAIDHEYEGCTATVLLIWFDQKKDCFAQCANLGDSACVMSVNGKMIEMTEDHRVASVTERARIARAGQALKAGEVRINGLNLARMFGDKFLKEQDSRFSSEPYVSQAVHITKACTAFAVIASDGLWDVISTKRAVQLVVEGRERNSGDSASADKVANRILSEARNLRTKDNTSVIFVDFD

HMMPfam: PF00481
IPR001932
317-567 PP2C
Protein phosphatase 2C-like

GKKLAMEDISFCQCPLQGVEQFGLFGIFDGHGGDGAARAVSKIFPENVATLLSHHETKEKVLSYSDASDVLRYAFTMTEAAIDHEYEGCTATVLLIWFDQKKDCFAQCANLGDSACVMSVNGKMIEMTEDHRVASVTERARIARAGQALKAGEVRINGLNLARMFGDKFLKEQDSRFSSEPYVSQAVHITKACTAFAVIASDGLWDVISTKRAVQLVVEGRERNSGDSASADKVANRILSEARNLRTKDNT

HMMSmart: SM00331
IPR001932
323-574 PP2C_SIG
Protein phosphatase 2C-like

EDISFCQCPLQGVEQFGLFGIFDGHGGDGAARAVSKIFPENVATLLSHHETKEKVLSYSDASDVLRYAFTMTEAAIDHEYEGCTATVLLIWFDQKKDCFAQCANLGDSACVMSVNGKMIEMTEDHRVASVTERARIARAGQALKAGEVRINGLNLARMFGDKFLKEQDSRFSSEPYVSQAVHITKACTAFAVIASDGLWDVISTKRAVQLVVEGRERNSGDSASADKVANRILSEARNLRTKDNTSVIFVDF

PatternScan: PS01032
IPR000222
340-348 PP2C
Protein phosphatase 2C, manganese/magnesium aspart

LFGIFDGHG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox