PRGDB00050954 (casein kinase I-like protein; similar to the rat delta isoform of casein kinase I, Swiss-Prot Accession Number Q06486.)

From PRG Wiki
Jump to: navigation, search
casein kinase I-like protein; similar to the rat delta isoform of casein kinase I, Swiss-Prot Accession Number Q06486.
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 549972 (U12857)
Gene Class Unknown
Domain Type Receptor-Like Kinase, Receptor-Like Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana Col-0 casein kinase I-like protein mRNA, complete cds.

DNA Sequence

ATGGAACCTCGTGTGGGGAACAAGTTTCGTCTCGGCCGAAAGATCGGTAGTGGTTCGTTTGGAGAGATCTATCTCGGTACTAATATTCATACGAATGAAGAACTGGCTATTAAGCTTGAAAATGTGAAGACAAAACATCAACAGCTGCTCTATGAATCGAAGTTATACAGGATTCTACAAGGGGGAACTGGTGTTCCAAATGTCAAATGGTTTGGTGTTGAAGGGGACTATAATGTTTTGGTGATGGATCTACTCGGACCAAGTCTTGAAGATCTCTTCAATTTTTGTAGCAGGAAACTTTCATTGAAGTCTGTCCTCATGCTTGCTGATCAAATGATCAACCGTGTTGAGTTTTTTCATTCAAAGTCTTTCCTTCACCGAGATCTTAAGCAGACCAACTTCCTCATGGGCCTTGGAAGGCGTGCGAACCAGGTATACATCATTGACTTTGGTCTTGCTAAGAAGTATAGGGATATGACAACACATCAGCACATTCCCTACAGGGAAAATAAAAACCTGACAGGAACTGCGAGATATGCTAGTATGAACACTCACTTGGGAATTGAACAAAGTCGAAGGGATGATCTTAAGTCTCTTGGTTACATCCTTATGTATTTCCTCAAAGGAAGTCTTCCATGGCAAGGACTGAAAGCTGGAACAAAAAAGAAAAAGTATGAAAGGATTAGTGAAAAGAAAGTTTCTACATCCATTGAGGCTTTATGTCCCATTGAGGCTTTATGTCGTGGTTACCCATCCGAATTTGCATCCTATTTCCACTACTGTCGGTCGCTTCGGTTTGATGATAAACCAGATTACGCTTATCTGAAAAGAATATTTCGAGATCTCTTTATCCGTGAAGGGTTTCAGTTTGATTACGTGTTTGACTGGACAATCTTGAAATATCAACAATCACAACTAACCGCTCCCCCATCTCGAGCCCTCAATCCTGCTGTGGGAACTAGTGCCGCATTGCCTCCGGGCATTTCCAACATCGATAGATACACAGGGGAGGAAGAAGGGCGACCACATACGGAATCATCTCGACGGAGAGTTTCAGGGGCTCTTGATAACTCAGGGAATATTTCGAACCAACCGACATCCTCAAGTGCTAGAGACTCCATGATCCCGAGCTCCTCGTTGTTTGCACAATCAGCAGGAGAGTAA


Protein sequences

Name Description Sequence
casein kinase I-like protein; similar to the rat delta isoform of casein kinase I, Swiss-Prot Accession Number Q06486. casein kinase I-like protein; similar to the rat delta isoform of casein kinase I, Swiss-Prot Accession Number Q06486.

MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHQQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKQTNFLMGLGRRANQVYIIDFGLAKKYRDMTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLKSLGYILMYFLKGSLPWQGLKAGTKKKKYERISEKKVSTSIEALCPIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKYQQSQLTAPPSRALNPAVGTSAALPPGISNIDRYTGEEEGRPHTESSRRRVSGALDNSGNISNQPTSSSARDSMIPSSSLFAQSAGE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11909
1-316 FAMILY NOT NAMED,CASEIN KINASE-RELATED

MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHQQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKQTNFLMGLGRRANQVYIIDFGLAKKYRDMTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLKSLGYILMYFLKGSLPWQGLKAGTKKKKYERISEKKVSTSIEALCPIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKYQQSQLTAPPSRALNP

HMMPanther: PTHR11909:SF18
1-316 CASEIN KINASE,CASEIN KINASE

MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHQQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKQTNFLMGLGRRANQVYIIDFGLAKKYRDMTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLKSLGYILMYFLKGSLPWQGLKAGTKKKKYERISEKKVSTSIEALCPIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKYQQSQLTAPPSRALNP

superfamily: SSF56112
IPR011009
5-296 Protein kinase-like (PK-like)
Protein kinase-like domain

VGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHQQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKQTNFLMGLGRRANQVYIIDFGLAKKYRDMTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLKSLGYILMYFLKGSLPWQGLKAGTKKKKYERISEKKVSTSIEALCPIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDW

HMMPfam: PF00069
IPR000719
9-244 Pkinase,Ser-thr
Protein kinase, catalytic domain

FRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHQQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKQTNFLMGLGRRANQVYIIDFGLAKKYRDMTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLKSLGYILMYFLKGSLPWQGLKAGTKKKKYERISEKKVSTSIEALCPIE

HMMSmart: SM00220
IPR002290
9-293 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHQQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKQTNFLMGLGRRANQVYIIDFGLAKKYRDMTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLKSLGYILMYFLKGSLPWQGLKAGTKKKKYERISEKKVSTSIEALCPIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYV

ProfileScan: PS50011
IPR000719
9-284 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHQQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKQTNFLMGLGRRANQVYIIDFGLAKKYRDMTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLKSLGYILMYFLKGSLPWQGLKAGTKKKKYERISEKKVSTSIEALCPIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFI

Gene3D: G3DSA:3.30.200.20
12-79 no description

GRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHQQLLYESKLYRILQGGTGVPNVKWFGVEGDYNV

PatternScan: PS00107
IPR017441
15-38 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGSFGEIYLGTNIHTNEELAIK

Coil: coil
32-53 coiled-coil

NEELAIKLENVKTKHQQLLYES

Gene3D: G3DSA:1.10.510.10
80-282 no description

LVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKQTNFLMGLGRRANQVYIIDFGLAKKYRDMTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLKSLGYILMYFLKGSLPWQGLKAGTKKKKYERISEKKVSTSIEALCPIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDL

PatternScan: PS00108
IPR008271
124-136 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FLHRDLKQTNFLM

Seg: seg
221-232 seg

KKKKYERISEKK


List of References

M Mindrinos, F Katagiri, G L Yu, F M Ausubel
The A. thaliana disease resistance gene RPS2 encodes a protein containing a nucleotide-binding site and leucine-rich repeats.
Cell: 1994, 78(6);1089-99
PubMed:7923358 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox