PRGDB00050955 (NADPH HC-toxin reductase)

From PRG Wiki
Jump to: navigation, search
NADPH HC-toxin reductase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 168642 (L02540)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays NADPH HC-toxin reductase mRNA, complete cds.

DNA Sequence

ATGGCCGAAAAGGAGAGCAACGGAGTGCGGGTGTGCGTCACCGGAGGAGCCGGGTTCATCGGCTCCTGGCTCGTCAGGAAGCTCCTCGAGAAAGGCTACACCGTCCACGCCACCCTGCGGAACACCGGGGACGAGGCGAAGGCGGGGCTGCTGCGTCGGCTGGTCCCCGGCGCGGCGGAGCGGCTGCGGTTGTTCCAGGCCGACCTCTTCGACGCCGCCACCTTCGCGCCGGCGATCGCTGGGTGCCAGTTCGTCTTCCTCGTCGCCACGCCATTCGGGCTCGATAGCGCCGGCTCCCAGTATAAGAGCACGGCGGAAGCTGTGGTGGACGCGGTGCGCGCGATCCTCCGGCAATGCGAGGAGTCCCGGACGGTGAAGCGAGTGATCCACACAGCCTCCGTAGCGGCCGCCTCGCCGTTGCTGGAGGAGGAGGTCTCCGCCTCCGGCGTCGGGTACAGAGACTTCATCGACGAATCTTGTTGGACTTCGCTCAACGTTGACTATCCTCTCCGAAGCGCACACTTCGACAAGTACATACTGTCGAAGCTGCGGTCAGAGCAGGAGCTCCTGAGCTACAACGGCGGCGAGAGCCCGGCGTTCGAGGTGGTGACCCTGCCGCTGGGGCTCGTGGCGGGCGACACGGTCCTCGGCCGCGCCCCGGAGACGGTGGAGAGCGCCGTGGCGCCCGTGTCCCGCAGCGAGCCCTGCTTCGGCCTCCTGCGCATACTGCAGCAGCTCCTGGGGTCGCTGCCGCTGGTGCACGTGGACGACGTCTGCGACGCGCTCGTCTTCTGCATGGAGCGGCGCCCCTCCGTCGCCGGCCGCTTCCTCTGCGCCGCCGCGTACCCGACGATCCACGACGTGGTCGCCCACTACGCCAGCAAGTTCCCTCACCTCGACATCTTGAAAGAGACGGAGGCGGTGGCGACGGTGCGGCCTGCCCGGGACAGGTTGGGCGAGCTGGGCTTCCAAGTACCAAGTACGGCATGGGAAGAGATTCTGGATAGCAGCGTTGCCTGTGCGGCGAGATTAGGTTCCCTTGACGCATCCAAGCTCGGCCTACAGAAAGGATAA


Protein sequences

Name Description Sequence
NADPH HC-toxin reductase NADPH HC-toxin reductase.

MAEKESNGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVRAILRQCEESRTVKRVIHTASVAAASPLLEEEVSASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLRSEQELLSYNGGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPCFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETEAVATVRPARDRLGELGFQVPSTAWEEILDSSVACAARLGSLDASKLGLQKG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366
1-348 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MAEKESNGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVRAILRQCEESRTVKRVIHTASVAAASPLLEEEVSASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLRSEQELLSYNGGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPCFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETEAVATVRPARDRLGELGFQVPSTAWEEILDSSVACAARLGSLD

HMMPanther: PTHR10366:SF78
1-348 PTHR10366:SF78,OS06G0651100 PROTEIN

MAEKESNGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVRAILRQCEESRTVKRVIHTASVAAASPLLEEEVSASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLRSEQELLSYNGGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPCFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETEAVATVRPARDRLGELGFQVPSTAWEEILDSSVACAARLGSLD

superfamily: SSF51735
7-343 NAD(P)-bd

NGVRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVRAILRQCEESRTVKRVIHTASVAAASPLLEEEVSASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLRSEQELLSYNGGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPCFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYASKFPHLDILKETEAVATVRPARDRLGELGFQVPSTAWEEILDSSVACAAR

Gene3D: G3DSA:3.40.50.720
IPR016040
9-294 NAD(P)-bd
NAD(P)-binding domain

VRVCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVRAILRQCEESRTVKRVIHTASVAAASPLLEEEVSASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLRSEQELLSYNGGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPCFGLLRILQQLLGSLPLVHVDDVCDALVFCMERRPSVAGRFLCAAAYPTIHDVVAHYAS

HMMPfam: PF01370
IPR001509
11-269 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGAGFIGSWLVRKLLEKGYTVHATLRNTGDEAKAGLLRRLVPGAAERLRLFQADLFDAATFAPAIAGCQFVFLVATPFGLDSAGSQYKSTAEAVVDAVRAILRQCEESRTVKRVIHTASVAAASPLLEEEVSASGVGYRDFIDESCWTSLNVDYPLRSAHFDKYILSKLRSEQELLSYNGGESPAFEVVTLPLGLVAGDTVLGRAPETVESAVAPVSRSEPCFGLLRILQQLLGSLPLVHVDDVCDALVFCMERR


List of References

G S Johal, S P Briggs
Reductase activity encoded by the HM1 disease resistance gene in maize.
Science: 1992, 258(5084);985-7
PubMed:1359642 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox