PRGDB00050958 (XA1)

From PRG Wiki
Jump to: navigation, search
XA1
Gene Type Reference_R-Genes,_manually_curated
GenBank 2943741 (AB002266)
Gene Class CNL
Domain Type LRR, NBS, Others
Chromosome 4
Gene Species Oryza sativa

Comment?

Oryza sativa mRNA for XA1, complete cds.

DNA Sequence

ATGGAGGAGGTGGAAGCCGGTTGGCTGGAGGGCGGGATCAGGTGGCTGGCGGAGACCATCCTGGATAACCTGGACGCCGACAAGCTGGATGAATGGATTCGCCAGATTAGGCTCGCCGCTGACACCGAGAAGCTACGGGCTGAGATCGAGAAGGTGGATGGGGTGGTGGCTGCCGTGAAGGGGAGGGCGATCGGGAACAGGTCGCTGGCCCGATCGCTCGGCCGTCTCAGGGGGTTGCTGTACGACGCCGACGATGCGGTCGACGAGCTCGACTACTTCAGGCTCCAGCAGCAGGTCGAGGGAGGAGTTACTACACGGTTTGAGGCTGAAGAGACGGTCGGAGATGGAGCAGAGGACGAGGACGATATTCCGATGGACAATACTGATGTACCGGAGGCAGTGGCGGCAGGCAGCAGCAAGAAACGGTCCAAGGCATGGGAACACTTTACTACCGTAGAGTTCACTGCTGACGGGAAGGATTCTAAAGCACGGTGCAAGTACTGCCACAAGGACCTATGTTGCACATCTAAGAACGGGACATCAGCTTTGCGCAACCATCTCAATGTTTGCAAGAGGAAACGTGTAACAAGTACTGACCAACCGGTAAATCCATCAAGTGCCGGTGAGGGTGCATCAAATGCAACTGGTAATTCAGTTGGCAGAAAAAGGATGAGAATGGATGGGACTTCAACACACCACGAGGCAGTTAGCACGCACCCTTGGAACAAGGCTGAACTTTCCAACAGGATCCAATGCATGACTCATCAGTTAGAAGAGGCTGTAAATGAGGTTATGAGGCTATGTCGATCCTCAAGTTCAAACCAGAGTCGACAGGGTACACCACCGGCCACAAATGCAACAACATCGTCTTATCTTCCGGAGCCCATAGTGTATGGGAGGGCTGCAGAGATGGAAACCATCAAACAGCTGATCATGAGCAATAGATCTAATGGCATAACCGTCCTGCCAATTGTAGGCAATGGAGGGATAGGAAAAACCACTTTGGCGCAACTGGTCTGCAAAGATCTGGTAATTAAAAGTCAGTTTAATGTTAAGATATGGGTGTATGTATCTGATAAATTTGATGTAGTTAAGATTACAAGGCAGATTTTGGATCATGTCTCCAACCAGAGCCACGAAGGAATAAGCAACCTTGATACGCTTCAGCAGGATCTTGAGGAACAAATGAAATCTAAGAAGTTCCTCATTGTCTTAGATGATGTGTGGGAAATCCGTACAGATGACTGGAAAAAACTACTGGCTCCTTTAAGACCTAATGATCAGGTGAATTCATCACAGGAAGAGGCAACAGGTAATATGATAATTTTGACAACTCGTATACAGAGTATTGCCAAAAGTCTTGGAACAGTACAATCAATTAAGTTAGAAGCTCTGAAAGATGACGATATATGGTCACTATTTAAAGTGCATGCTTTTGGTAATGATAAACATGATAGTAGTCCAGGCTTACAGGTTCTTGGGAAGCAAATTGCTAGCGAGCTAAAAGGCAACCCACTGGCAGCAAAAACTGTGGGTTCACTATTAGGAACGAATCTTACCATCGATCATTGGGATAGCATTATAAAGAGTGAAGAATGGAAATCCCTGCAACAAGCTTATGGCATCATGCAAGCGCTGAAGTTGAGCTATGATCATCTATCCAACCCCTTACAGCAATGCGTCTCTTATTGTTCTCTTTTCCCCAAGGGTTATTCTTTCAGCAAAGCACAACTAATACAAATATGGATTGCTCAAGGATTTGTGGAAGAATCCAGTGAGAAGTTGGAGCAGAAAGGATGGAAATATCTAGCTGAGTTGGTAAATTCGGGTTTCCTTCAGCAAGTTGAAAGCACACGGTTTTCATCAGAATATTTTGTTATGCACGATCTTATGCATGATTTAGCGCAAAAGGTTTCACAAACAGAATATGCAACTATAGATGGCTCAGAGTGCACAGAGTTAGCCCCAAGTATACGCCATTTGTCAATAGTAACTGATTCTGCATACCGCAAGGAGAAATATAGAAACATATCTCGTAATGAGGTGTTTGAGAAAAGGTTGATGAAAGTTAAGTCAAGGAGTAAGTTGAGGTCACTGGTATTAATTGGGCAATATGATTCTCATTTTTTTAAATATTTCAAAGATGCTTTCAAGGAAGCACAACATCTGCGACTGCTGCAGATCACTGCAACTTATGCTGATTCTGATTCATTTCTCTCCAGTTTGGTAAATTCTACACATCTCCGGTATCTGAAAATTGTGACCGAAGAATCCGGCAGAACTTTGCCCCGATCTCTAAGGAAGTATTACCATCTTCAAGTACTAGATATTGGCTATAGATTTGGAATTCCCCGTATATCTAATGATATAAATAATCTTCTCAGCCTGCGGCATCTTGTTGCATATGATGAAGTGTGTTCTTCCATTGCTAACATTGGTAAAATGACCTCACTTCAGGAACTAGGCAATTTTATTGTTCAGAATAATTTAAGTGGTTTTGAGGTGACACAATTGAAATCCATGAACAAGCTTGTACAACTTAGTGTGTCTCAGCTTGAAAATGTTAGAACTCAGGAGGAGGCATGTGGGGCAAAACTGAAAGACAAACAACACTTAGAAAAGCTACATTTGTCCTGGAAGGATGCATGGAATGGATATGACAGTGACGAAAGCTATGAAGATGAATACGGCAGTGATATGAATATAGAAACAGAAGGGGAGGAACTGTCAGTTGGTGATGCCAATGGTGCCCAAAGCTTACAACATCACAGTAATATAAGCTCTGAACTTGCTTCAAGTGAGGTGCTCGAAGGTCTTGAACCACATCACGGCCTCAAGTATCTACGGATATCTGGGTATAATGGATCTACCTCCCCAACTTGGCTTCCTTCTTCACTTACCTGTCTGCAAACACTTCATCTAGAAAAATGTGGAAAATGGCAAATACTTCCTTTAGAAAGGCTAGGGTTACTTGTAAAGCTCGTGTTGATCAAAATGAGGAATGCAACAGAACTCTCAATCCCTTCACTGGAGGAGCTTGTGTTAATTGCATTGCCAAGCTTGAACACATGCTCCTGCACTTCCATCAGGAACTTGAACTCCAGTTTAAAGGTTCTGAAAATTAAGAATTGCCCTGTACTGAAGGTATTTCCCTTGTTTGAGATTTCCCAGAAATTTGAAATCGAGCGGACGTCGTCATGGTTGCCCCATCTTAGCAAGCTTACCATCTATAATTGTCCTCTTTCCTGTGTGCACAGTTCTCTGCCACCTTCCGCAATCAGTGGTTATGGAGAATATGGAAGGTGTACCCTTCCGCAATCACTTGAGGAACTTTACATCCATGAGTATTCTCAAGAAACTCTGCAGCCCTGCTTTTCAGGGAACCTCACTCTCCTGAGAAAATTACATGTACTGGGAAACTCAAATTTAGTGTCTCTGCAGCTCCATTCCTGCACAGCACTCGAAGAGTTGATAATTCAAAGCTGTGAGTCTCTTAGTTCTCTGGATGGCTTGCAATTGCTTGGCAATCTCAGGTTGCTGCGGGCACATAGATGCCTCAGTGGTCATGGAGAAGATGGAAGGTGTATCCTTCCGCAATCACTTGAGGAACTTTACATCCATGAGTATTCTCAAGAAACTCTGCAGCCCTGCTTTTCAGGGAACCTCACTCTCCTGAGAAAATTACATGTACTGGGAAACTCAAATTTAGTGTCTCTGCAGCTCCATTCCTGCACAGCACTCGAAGAGTTGATAATTCAAAGCTGTGAGTCTCTTAGTTCTCTGGATGGCTTGCAATTGCTTGGCAATCTCAGGTTGCTGCGGGCACATAGATGCCTCAGTGGTCATGGAGAAGATGGAAGGTGTATCCTTCCGCAATCACTTGAGGAACTTTACATCCATGAGTATTCTCAAGAAACTCTGCAGCCCTGCTTTTCAGGGAACCTCACTCTCCTGAGAAAATTACATGTACTGGGAAACTCAAATTTCGTGTCTCTGCAGCTCCATTCCTGCACAGCACTCGAAGAGTTGATAATTCAAAGCTGTGAGTCTCTTAGTTCTCTGGATGGCTTGCAATTGCTTGGCAATCTCAGGTTGCTGCAGGCACATAGATGCCTCAGTGGTCATGGAGAAGATGGAAGGTGTATCCTTCCGCAATCACTTGAGGAACTTTACATCCATGAGTATTCTCAAGAAACTCTGCAGCCCTGCTTTTCAGGGAACCTCACTCTCCTGAGAAAATTACATGTACTTGGAAACTCAAATTTAGTGTCTCTGCAGCTCCATTCCTGCACAGCACTCGAAGAGTTGATAATTCAAAGCTGTGAGTCTCTTAGTTCTCTGGATGGCTTGCAATTGCTTGGCAATCTCAGGTTGCTGCAGGCACATAGATGCCTCAGTGGTCATGGAGAAGATGGAAGGTGTATCCTTCCGCAATCACTTGAGGAACTTTACATCCATGAGTATTCTCAAGAAACTCTGCAGCCCTGCTTTTCAGGGAACCTCACTCTCCTGAGAAAATTACATGTACTGGGAAACTCAAATTTAGTGTCTCTGCAGCTCCATTCCTGCACATCACTCGAAGAGTTGAAAATTCAAAGCTGTGAGTCTCTTAGTTCTCTGGATGGCTTGCAATTGCTTGGCAATCTCAGGTTGCTGCAGGCACATAGATGCCTCAGTGGTCATGGAGAAGATGGAAGGTGTATCCTTCCGCAATCACTTGAGGAACTTTTCATCAGTGAGTATTCTCTAGAAACTCTGCAGCCCTGCTTCCTGACGAATCTCACCTGCTTAAAACAATTAGAGGTATCAGGCACCACAAGTTTAAAATCTCTAGAACTGCAATCATGCACTGCACTCGAACATTTGAAGATTCAAGGTTGTGCGTCGCTTGCTACATTGGAGGGGTTGCAATTCCTCCACGCCCTCAGGCATATGAAAGTATTCAGATGCCCTGGCTTGCCTCCATATTTGGGGAGTTCGTCAGAGCAGGGCTATGAGCTATGCCCACGACTGGAAAGGCTCGACATCGATGACCCCTCTATCCTTACCACGTCGTTCTGCAAGCACCTCACCTCCCTCCAACGCCTAGAGCTTAACTATTGCGGAAGTGAAGTGGCAAGACTAACGGATGAGCAAGAGAGAGCGCTTCAGCTCCTCACGTCCCTGCAAGAGCTCCGGTTTAAGTATTGCTACAATCTCATAGATCTTCCTGCGGGGCTCCACAGCCTTCCCTCCCTCAAGAGGTTGGAGATCCGGAGTTGCAGGAGCATCGCGAGGCTGCCGGAGAAGGGCCTCCCACCTTCGTTCGAAGAACTGGATATCATCGCTTGCAGTAATGAGCTAGCTCAGCAGTGCAGAACTCTAGCAAGCACTCTGAAGGTCAAAATTAATGGGGGATATGTGAACTGA


Protein sequences

Name Description Sequence
XA1 XA1 [Oryza sativa (indica cultivar-group)].

MEEVEAGWLEGGIRWLAETILDNLDADKLDEWIRQIRLAADTEKLRAEIEKVDGVVAAVKGRAIGNRSLARSLGRLRGLLYDADDAVDELDYFRLQQQVEGGVTTRFEAEETVGDGAEDEDDIPMDNTDVPEAVAAGSSKKRSKAWEHFTTVEFTADGKDSKARCKYCHKDLCCTSKNGTSALRNHLNVCKRKRVTSTDQPVNPSSAGEGASNATGNSVGRKRMRMDGTSTHHEAVSTHPWNKAELSNRIQCMTHQLEEAVNEVMRLCRSSSSNQSRQGTPPATNATTSSYLPEPIVYGRAAEMETIKQLIMSNRSNGITVLPIVGNGGIGKTTLAQLVCKDLVIKSQFNVKIWVYVSDKFDVVKITRQILDHVSNQSHEGISNLDTLQQDLEEQMKSKKFLIVLDDVWEIRTDDWKKLLAPLRPNDQVNSSQEEATGNMIILTTRIQSIAKSLGTVQSIKLEALKDDDIWSLFKVHAFGNDKHDSSPGLQVLGKQIASELKGNPLAAKTVGSLLGTNLTIDHWDSIIKSEEWKSLQQAYGIMQALKLSYDHLSNPLQQCVSYCSLFPKGYSFSKAQLIQIWIAQGFVEESSEKLEQKGWKYLAELVNSGFLQQVESTRFSSEYFVMHDLMHDLAQKVSQTEYATIDGSECTELAPSIRHLSIVTDSAYRKEKYRNISRNEVFEKRLMKVKSRSKLRSLVLIGQYDSHFFKYFKDAFKEAQHLRLLQITATYADSDSFLSSLVNSTHLRYLKIVTEESGRTLPRSLRKYYHLQVLDIGYRFGIPRISNDINNLLSLRHLVAYDEVCSSIANIGKMTSLQELGNFIVQNNLSGFEVTQLKSMNKLVQLSVSQLENVRTQEEACGAKLKDKQHLEKLHLSWKDAWNGYDSDESYEDEYGSDMNIETEGEELSVGDANGAQSLQHHSNISSELASSEVLEGLEPHHGLKYLRISGYNGSTSPTWLPSSLTCLQTLHLEKCGKWQILPLERLGLLVKLVLIKMRNATELSIPSLEELVLIALPSLNTCSCTSIRNLNSSLKVLKIKNCPVLKVFPLFEISQKFEIERTSSWLPHLSKLTIYNCPLSCVHSSLPPSAISGYGEYGRCTLPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLRAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLRAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNFVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTSLEELKIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELFISEYSLETLQPCFLTNLTCLKQLEVSGTTSLKSLELQSCTALEHLKIQGCASLATLEGLQFLHALRHMKVFRCPGLPPYLGSSSEQGYELCPRLERLDIDDPSILTTSFCKHLTSLQRLELNYCGSEVARLTDEQERALQLLTSLQELRFKYCYNLIDLPAGLHSLPSLKRLEIRSCRSIARLPEKGLPPSFEELDIIACSNELAQQCRTLASTLKVKINGGYVN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23125:SF182
1-1802 PTHR23125:SF182,OS04G0622600 PROTEIN

MEEVEAGWLEGGIRWLAETILDNLDADKLDEWIRQIRLAADTEKLRAEIEKVDGVVAAVKGRAIGNRSLARSLGRLRGLLYDADDAVDELDYFRLQQQVEGGVTTRFEAEETVGDGAEDEDDIPMDNTDVPEAVAAGSSKKRSKAWEHFTTVEFTADGKDSKARCKYCHKDLCCTSKNGTSALRNHLNVCKRKRVTSTDQPVNPSSAGEGASNATGNSVGRKRMRMDGTSTHHEAVSTHPWNKAELSNRIQCMTHQLEEAVNEVMRLCRSSSSNQSRQGTPPATNATTSSYLPEPIVYGRAAEMETIKQLIMSNRSNGITVLPIVGNGGIGKTTLAQLVCKDLVIKSQFNVKIWVYVSDKFDVVKITRQILDHVSNQSHEGISNLDTLQQDLEEQMKSKKFLIVLDDVWEIRTDDWKKLLAPLRPNDQVNSSQEEATGNMIILTTRIQSIAKSLGTVQSIKLEALKDDDIWSLFKVHAFGNDKHDSSPGLQVLGKQIASELKGNPLAAKTVGSLLGTNLTIDHWDSIIKSEEWKSLQQAYGIMQALKLSYDHLSNPLQQCVSYCSLFPKGYSFSKAQLIQIWIAQGFVEESSEKLEQKGWKYLAELVNSGFLQQVESTRFSSEYFVMHDLMHDLAQKVSQTEYATIDGSECTELAPSIRHLSIVTDSAYRKEKYRNISRNEVFEKRLMKVKSRSKLRSLVLIGQYDSHFFKYFKDAFKEAQHLRLLQITATYADSDSFLSSLVNSTHLRYLKIVTEESGRTLPRSLRKYYHLQVLDIGYRFGIPRISNDINNLLSLRHLVAYDEVCSSIANIGKMTSLQELGNFIVQNNLSGFEVTQLKSMNKLVQLSVSQLENVRTQEEACGAKLKDKQHLEKLHLSWKDAWNGYDSDESYEDEYGSDMNIETEGEELSVGDANGAQSLQHHSNISSELASSEVLEGLEPHHGLKYLRISGYNGSTSPTWLPSSLTCLQTLHLEKCGKWQILPLERLGLLVKLVLIKMRNATELSIPSLEELVLIALPSLNTCSCTSIRNLNSSLKVLKIKNCPVLKVFPLFEISQKFEIERTSSWLPHLSKLTIYNCPLSCVHSSLPPSAISGYGEYGRCTLPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLRAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLRAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNFVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTSLEELKIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELFISEYSLETLQPCFLTNLTCLKQLEVSGTTSLKSLELQSCTALEHLKIQGCASLATLEGLQFLHALRHMKVFRCPGLPPYLGSSSEQGYELCPRLERLDIDDPSILTTSFCKHLTSLQRLELNYCGSEVARLTDEQERALQLLTSLQELRFKYCYNLIDLPAGLHSLPSLKRLEIRSCRSIARLPEKGLPPSFEELDIIACSNELAQQCRTLASTLKVKINGGYVN

HMMPanther: PTHR23125
1-1802 PTHR23125,F-BOX/LEUCINE RICH REPEAT PROTEIN

MEEVEAGWLEGGIRWLAETILDNLDADKLDEWIRQIRLAADTEKLRAEIEKVDGVVAAVKGRAIGNRSLARSLGRLRGLLYDADDAVDELDYFRLQQQVEGGVTTRFEAEETVGDGAEDEDDIPMDNTDVPEAVAAGSSKKRSKAWEHFTTVEFTADGKDSKARCKYCHKDLCCTSKNGTSALRNHLNVCKRKRVTSTDQPVNPSSAGEGASNATGNSVGRKRMRMDGTSTHHEAVSTHPWNKAELSNRIQCMTHQLEEAVNEVMRLCRSSSSNQSRQGTPPATNATTSSYLPEPIVYGRAAEMETIKQLIMSNRSNGITVLPIVGNGGIGKTTLAQLVCKDLVIKSQFNVKIWVYVSDKFDVVKITRQILDHVSNQSHEGISNLDTLQQDLEEQMKSKKFLIVLDDVWEIRTDDWKKLLAPLRPNDQVNSSQEEATGNMIILTTRIQSIAKSLGTVQSIKLEALKDDDIWSLFKVHAFGNDKHDSSPGLQVLGKQIASELKGNPLAAKTVGSLLGTNLTIDHWDSIIKSEEWKSLQQAYGIMQALKLSYDHLSNPLQQCVSYCSLFPKGYSFSKAQLIQIWIAQGFVEESSEKLEQKGWKYLAELVNSGFLQQVESTRFSSEYFVMHDLMHDLAQKVSQTEYATIDGSECTELAPSIRHLSIVTDSAYRKEKYRNISRNEVFEKRLMKVKSRSKLRSLVLIGQYDSHFFKYFKDAFKEAQHLRLLQITATYADSDSFLSSLVNSTHLRYLKIVTEESGRTLPRSLRKYYHLQVLDIGYRFGIPRISNDINNLLSLRHLVAYDEVCSSIANIGKMTSLQELGNFIVQNNLSGFEVTQLKSMNKLVQLSVSQLENVRTQEEACGAKLKDKQHLEKLHLSWKDAWNGYDSDESYEDEYGSDMNIETEGEELSVGDANGAQSLQHHSNISSELASSEVLEGLEPHHGLKYLRISGYNGSTSPTWLPSSLTCLQTLHLEKCGKWQILPLERLGLLVKLVLIKMRNATELSIPSLEELVLIALPSLNTCSCTSIRNLNSSLKVLKIKNCPVLKVFPLFEISQKFEIERTSSWLPHLSKLTIYNCPLSCVHSSLPPSAISGYGEYGRCTLPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLRAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLRAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNFVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTSLEELKIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELFISEYSLETLQPCFLTNLTCLKQLEVSGTTSLKSLELQSCTALEHLKIQGCASLATLEGLQFLHALRHMKVFRCPGLPPYLGSSSEQGYELCPRLERLDIDDPSILTTSFCKHLTSLQRLELNYCGSEVARLTDEQERALQLLTSLQELRFKYCYNLIDLPAGLHSLPSLKRLEIRSCRSIARLPEKGLPPSFEELDIIACSNELAQQCRTLASTLKVKINGGYVN

HMMSmart: SM00614
IPR003656
140-193 ZnF_BED
Zinc finger, BED-type predicted

KKRSKAWEHFTTVEFTADGKDSKARCKYCHKDLCCTSKNGTSALRNHLNVCKRK

ProfileScan: PS50808
IPR003656
140-197 ZF_BED
Zinc finger, BED-type predicted

KKRSKAWEHFTTVEFTADGKDSKARCKYCHKDLCCTSKNGTSALRNHLNVCKRKRVTS

superfamily: SSF57667
143-202 SSF57667

SKAWEHFTTVEFTADGKDSKARCKYCHKDLCCTSKNGTSALRNHLNVCKRKRVTSTDQPV

HMMPfam: PF02892
IPR003656
143-191 zf-BED
Zinc finger, BED-type predicted

SKAWEHFTTVEFTADGKDSKARCKYCHKDLCCTSKNGTSALRNHLNVCK

superfamily: SSF52540
279-539 SSF52540

GTPPATNATTSSYLPEPIVYGRAAEMETIKQLIMSNRSNGITVLPIVGNGGIGKTTLAQLVCKDLVIKSQFNVKIWVYVSDKFDVVKITRQILDHVSNQSHEGISNLDTLQQDLEEQMKSKKFLIVLDDVWEIRTDDWKKLLAPLRPNDQVNSSQEEATGNMIILTTRIQSIAKSLGTVQSIKLEALKDDDIWSLFKVHAFGNDKHDSSPGLQVLGKQIASELKGNPLAAKTVGSLLGTNLTIDHWDSIIKSEEWKSLQQA

Gene3D: G3DSA:3.40.50.300
297-447 G3DSA:3.40.50.300

VYGRAAEMETIKQLIMSNRSNGITVLPIVGNGGIGKTTLAQLVCKDLVIKSQFNVKIWVYVSDKFDVVKITRQILDHVSNQSHEGISNLDTLQQDLEEQMKSKKFLIVLDDVWEIRTDDWKKLLAPLRPNDQVNSSQEEATGNMIILTTRI

HMMPfam: PF00931
IPR002182
302-591 NB-ARC,NBS
NB-ARC

AEMETIKQLIMSNRSNGITVLPIVGNGGIGKTTLAQLVCKDLVIKSQFNVKIWVYVSDKFDVVKITRQILDHVSNQSHEGISNLDTLQQDLEEQMKSKKFLIVLDDVWEIRTDDWKKLLAPLRPNDQVNSSQEEATGNMIILTTRIQSIAKSLGTVQSIKLEALKDDDIWSLFKVHAFGNDKHDSSPGLQVLGKQIASELKGNPLAAKTVGSLLGTNLTIDHWDSIIKSEEWKSLQQAYGIMQALKLSYDHLSNPLQQCVSYCSLFPKGYSFSKAQLIQIWIAQGFVEES

FPrintScan: PR00364
IPR000767
321-336 DISEASERSIST
Disease resistance protein

VLPIVGNGGIGKTTLA

FPrintScan: PR00364
IPR000767
395-409 DISEASERSIST
Disease resistance protein

QMKSKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
501-515 DISEASERSIST
Disease resistance protein

LKGNPLAAKTVGSLL

superfamily: SSF52058
626-1083 SSF52058,LRR

VMHDLMHDLAQKVSQTEYATIDGSECTELAPSIRHLSIVTDSAYRKEKYRNISRNEVFEKRLMKVKSRSKLRSLVLIGQYDSHFFKYFKDAFKEAQHLRLLQITATYADSDSFLSSLVNSTHLRYLKIVTEESGRTLPRSLRKYYHLQVLDIGYRFGIPRISNDINNLLSLRHLVAYDEVCSSIANIGKMTSLQELGNFIVQNNLSGFEVTQLKSMNKLVQLSVSQLENVRTQEEACGAKLKDKQHLEKLHLSWKDAWNGYDSDESYEDEYGSDMNIETEGEELSVGDANGAQSLQHHSNISSELASSEVLEGLEPHHGLKYLRISGYNGSTSPTWLPSSLTCLQTLHLEKCGKWQILPLERLGLLVKLVLIKMRNATELSIPSLEELVLIALPSLNTCSCTSIRNLNSSLKVLKIKNCPVLKVFPLFEISQKFEIERTSSWLPHLSKLTIYNCPLSC

Gene3D: G3DSA:3.80.10.10
694-880 G3DSA:3.80.10.10

SKLRSLVLIGQYDSHFFKYFKDAFKEAQHLRLLQITATYADSDSFLSSLVNSTHLRYLKIVTEESGRTLPRSLRKYYHLQVLDIGYRFGIPRISNDINNLLSLRHLVAYDEVCSSIANIGKMTSLQELGNFIVQNNLSGFEVTQLKSMNKLVQLSVSQLENVRTQEEACGAKLKDKQHLEKLHLSWK

Gene3D: G3DSA:3.80.10.10
927-1073 G3DSA:3.80.10.10

SSELASSEVLEGLEPHHGLKYLRISGYNGSTSPTWLPSSLTCLQTLHLEKCGKWQILPLERLGLLVKLVLIKMRNATELSIPSLEELVLIALPSLNTCSCTSIRNLNSSLKVLKIKNCPVLKVFPLFEISQKFEIERTSSWLPHLSK

FPrintScan: PR00364
IPR000767
1031-1047 DISEASERSIST
Disease resistance protein

NLNSSLKVLKIKNCPVL

superfamily: SSF52058
1068-1371 SSF52058,LRR

LPHLSKLTIYNCPLSCVHSSLPPSAISGYGEYGRCTLPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLRAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLRAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNFVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLQAHRC

Gene3D: G3DSA:3.80.10.10
1074-1234 G3DSA:3.80.10.10

LTIYNCPLSCVHSSLPPSAISGYGEYGRCTLPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLRAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNS

Gene3D: G3DSA:3.80.10.10
1239-1420 G3DSA:3.80.10.10

LQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLRAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNFVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNS

superfamily: SSF52058
1364-1778 SSF52058,LRR

RLLQAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTSLEELKIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELFISEYSLETLQPCFLTNLTCLKQLEVSGTTSLKSLELQSCTALEHLKIQGCASLATLEGLQFLHALRHMKVFRCPGLPPYLGSSSEQGYELCPRLERLDIDDPSILTTSFCKHLTSLQRLELNYCGSEVARLTDEQERALQLLTSLQELRFKYCYNLIDLPAGLHSLPSLKRLEIRSCRSIARLPEKGLPPSFEELDIIACS

Gene3D: G3DSA:3.80.10.10
1424-1618 G3DSA:3.80.10.10

SLQLHSCTALEELIIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELYIHEYSQETLQPCFSGNLTLLRKLHVLGNSNLVSLQLHSCTSLEELKIQSCESLSSLDGLQLLGNLRLLQAHRCLSGHGEDGRCILPQSLEELFISEYSLETLQPCFLTNLTCLKQLEVSGTTSLKSLELQSCTA

Gene3D: G3DSA:3.80.10.10
1619-1786 G3DSA:3.80.10.10

LEHLKIQGCASLATLEGLQFLHALRHMKVFRCPGLPPYLGSSSEQGYELCPRLERLDIDDPSILTTSFCKHLTSLQRLELNYCGSEVARLTDEQERALQLLTSLQELRFKYCYNLIDLPAGLHSLPSLKRLEIRSCRSIARLPEKGLPPSFEELDIIACSNELAQQCR


Diseases

Disease Pathogen Avirulence gene
Bacterial Blight

List of References

S Yoshimura, U Yamanouchi, Y Katayose, S Toki, Z X Wang, I Kono, N Kurata, M Yano, N Iwata, T Sasaki
Expression of Xa1, a bacterial blight-resistance gene in rice, is induced by bacterial inoculation.
Proc. Natl. Acad. Sci. U.S.A.: 1998, 95(4);1663-8
PubMed:9465073 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox