PRGDB00050959 (RPP1)

From PRG Wiki
Jump to: navigation, search
RPP1
Gene Type Reference_R-Genes,_manually_curated
GenBank 30692150 (NM_114316)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Chromosome 3
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RPP1 (RECOGNITION OF PERONOSPORA PARASITICA 1) (RPP1) mRNA, complete cds.

DNA Sequence

ATGGGTTCTGTAATGAGCTTGGGCTGTTCCAAGAGGAAAGCAACAAATCAGGATGTTGATTCCGAATCTCGTAAAAGACGAAAGATATGCTCAACAAACGATGCTGAGAATTGCAGATTCATTCAGGATGAGTCATCTTGGAAACATCCATGGAGTTTATGTGCCAACAGAGTCATCAGTGTGGCAGCCGTAGCTTTAACAAATTTCAGATTCCAACAAGATAACCAAGAAAGTAATTCTTCTTCTTTATCTCTTCCCTCCCCTGCAACTTCTGTGTCTCGAAACTGGAAACACGATGTCTTCCCGAGCTTCCACGGAGCAGATGTCCGAAGAACCTTTCTTAGTCACATCATGGAATCGTTCAGAAGAAAGGGAATTGACACATTCATTGATAATAATATAGAGAGGAGTAAGTCGATCGGTCCTGAGCTCAAAGAAGCTATCAAAGGATCAAAGATCGCAATCGTTTTGCTCTCAAGAAAATATGCTTCTTCGTCTTGGTGTCTTGATGAGTTGGCCGAGATCATGAAATGCAGGCAAATGGTGGGTCAGATTGTCATGACCATTTTCTATGAAGTTGATCCAACTGACATAAAGAAACAGACCGGTGAATTTGGAAAAGCCTTCACAAAAACATGTAGAGGTAAACCAAAAGAGCAAGTTGAGAGATGGAGAAAAGCTTTGGAGGATGTGGCAACAATCGCCGGATATCATTCTCACAGCTGGAGGAATGAAGCAGACATGATTGAGAAAATATCCACTGATGTTTCAAACATGTTAAATAGTTTCACACCATCAAGAGATTTCGACGGGTTAGTAGGGATGAGAGCTCATATGGATATGCTGGAACAATTGTTGCGCCTAGATTTGGATGAAGTAAGGATGATCGGGATTTGGGGACCGCCTGGGATTGGTAAGACAACTATCGCCAGATTTCTGTTTAATCAAGTCTCCGACAGATTCCAACTTAGTGCAATCATGGTCAATATCAAAGGATGCTATCCAAGACCTTGTTTCGATGAGTACAGTGCACAATTGCAACTACAAAACCAAATGTTGTCCCAGATGATCAATCATAAAGATATCATGATTTCTCATTTAGGAGTGGCTCAAGAACGGTTGAGAGACAAGAAAGTGTTTCTTGTTCTCGATGAAGTGGATCAATTAGGACAACTAGATGCCTTGGCGAAAGAAACTCGATGGTTTGGTCCTGGAAGTCGGATTATTATCACAACAGAAGATCTAGGAGTTTTGAAGGCTCATGGGATCAATCATGTTTACAAGGTCGAATATCCATCAAATGACGAGGCTTTTCAAATCTTCTGTATGAATGCCTTTGGTCAGAAACAACCACATGAAGGTTTCGATGAGATTGCTTGGGAAGTTACCTGCCTTGCTGGTGAACTTCCTTTGGGATTGAAGGTTCTAGGCTCTGCTTTGCGGGGGAAGTCCAAGCGAGAGTGGGAAAGAACACTACCAAGGTTAAAAACTAGCCTCGACGGAAAAATCGGGAGCATTATACAGTTCAGTTACGATGTCTTATGTGACGAAGATAAATATCTATTTCTTTATATAGCCTGTCTTTTTAACGGCGAATCAACAACCAAAGTGAAAGAGCTTCTTGGAAAGTTCTTGGATGTGAAACAAGGTCTTCACTTATTAGCTCAGAAATCTCTCATATCCTTTGATGGAGAAAGAATACATATGCATACTCTGCTCGAACAATTCGGAAGAGAAACTTCTCGTAAGCAATTCGTTCATCATGGCTTTACGAAACGTCAGCTTTTGGTTGGTGCAAGGGGTATATGTGAAGTGCTCGACGATGATACAACAGATAGTAGACGTTTTATAGGGATACATTTGGAGTTGTCTAATACCGAGGAAGAATTGAATATAAGTGAGAAAGTACTTGAAAGAGTGCATGATTTTCATTTCGTTAGAATCGATGCTAGTTTTCAACCTGAGAGACTGCAGTTAGCACTACAAGATCTGATTTATCATTCTCCAAAGATTAGATCACTGAACTGGTATGGTTACGAGAGTTTATGTTTGCCTTCAACTTTTAATCCGGAGTTTCTGGTCGAACTTGATATGCGTTCCAGCAATCTTCGGAAGCTATGGGAAGGAACTAAACAACTTAGAAATCTCAAGTGGATGGATTTGAGTTATTCTAGTTATCTGAAAGAGCTTCCCAATCTTTCAACTGCAACTAATCTCGAAGAATTAAAGCTTAGAAATTGCTCAAGTTTAGTGGAGCTCCCCTCCTCTATTGAAAAACTCACGAGTCTCCAAATATTAGATCTTGAAAATTGTTCGAGTCTTGAGAAGCTCCCCGCTATCGAGAATGCGACTAAGCTCCGTGAATTGAAGCTCCAAAATTGCTCAAGTCTAATAGAGCTCCCTCTTTCTATTGGAACTGCCACAAATCTGAAGCAATTGAATATTAGCGGATGCTCAAGTCTCGTGAAACTCCCATCCTCAATTGGAGATATCACTGATCTCGAAGTGTTTGATCTATCTAACTGCTCAAGTCTGGTGACGCTTCCTTCCTCTATAGGAAACCTTCAAAACTTGTGCAAGTTAATTATGAGAGGATGCTCAAAGCTAGAGGCTCTTCCAATCAACATCAACTTGAAATCTCTCGATACACTTAATCTCACAGATTGCTCTCAGTTGAAAAGTTTTCCTGAGATCTCCACACACATTTCAGAGCTCAGGTTAAAAGGAACTGCAATAAAAGAAGTTCCCTTGTCGATCATGTCGTGGTCTCCTCTTGCTGACTTTCAGATTTCATACTTTGAAAGCCTCATGGAATTCCCGCATGCTTTTGACATCATCACGAAGCTGCATTTGAGCAAAGATATACAAGAAGTTCCTCCATGGGTCAAGAGAATGTCTCGTTTACGTGATCTTAGTCTCAACAACTGCAATAATCTGGTATCACTCCCCCAACTTTCAGATTCCCTTGATTACATATATGCAGATAATTGTAAGTCCCTCGAGAGACTGGATTGTTGCTTTAACAATCCAGAGATCCGTCTCTATTTCCCCAAATGCTTCAAACTGAATCAAGAAGCCAGAGATCTCATCATGCACACTTGTATAGATGCGATGTTTCCAGGTACACAAGTGCCTGCCTGCTTCATTCATCGAGCTACTTCTGGGGATTCCTTGAAAATCAAGTTGAAGGAGTCGCCTCTTCCTACAACCTTGAGATTTAAGGCTTGTATCATGCTTGTTAAGGTTAATGAAGAACTGATGAGTTATGATCAGACACCGATGATCGTTGACATTGTCATCAGGGACGAACATAATGATCTCAAAGAAAAGATATATCCAAGCATATATCCAAGCATATATCCACTTTTAACAGAGCATATATACACATTTGAACTTGACGTAGAGGAGGTGACTTCCACGGAGCTTGTCTTTGAGTTCCCACAACTCAACAAAAGAAATTGGAAGATAGGAGAATGCGGGATACTCCAAAGAGAAACGAGATCACTTCGCCGGAGCTCTTCGCCGGATCTCTCGCCGGAATCTTCTCGTGTTTCTAGCTACGACCACTGTTTGAGAGGTGATTGA


Protein sequences

Name Description Sequence
RPP1 (RECOGNITION OF PERONOSPORA PARASITICA 1) RPP1 (RECOGNITION OF PERONOSPORA PARASITICA 1) [Arabidopsis thaliana].

MGSVMSLGCSKRKATNQDVDSESRKRRKICSTNDAENCRFIQDESSWKHPWSLCANRVISVAAVALTNFRFQQDNQESNSSSLSLPSPATSVSRNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATIAGYHSHSWRNEADMIEKISTDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPHEGFDEIAWEVTCLAGELPLGLKVLGSALRGKSKREWERTLPRLKTSLDGKIGSIIQFSYDVLCDEDKYLFLYIACLFNGESTTKVKELLGKFLDVKQGLHLLAQKSLISFDGERIHMHTLLEQFGRETSRKQFVHHGFTKRQLLVGARGICEVLDDDTTDSRRFIGIHLELSNTEEELNISEKVLERVHDFHFVRIDASFQPERLQLALQDLIYHSPKIRSLNWYGYESLCLPSTFNPEFLVELDMRSSNLRKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLENCSSLEKLPAIENATKLRELKLQNCSSLIELPLSIGTATNLKQLNISGCSSLVKLPSSIGDITDLEVFDLSNCSSLVTLPSSIGNLQNLCKLIMRGCSKLEALPININLKSLDTLNLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSIMSWSPLADFQISYFESLMEFPHAFDIITKLHLSKDIQEVPPWVKRMSRLRDLSLNNCNNLVSLPQLSDSLDYIYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTCIDAMFPGTQVPACFIHRATSGDSLKIKLKESPLPTTLRFKACIMLVKVNEELMSYDQTPMIVDIVIRDEHNDLKEKIYPSIYPSIYPLLTEHIYTFELDVEEVTSTELVFEFPQLNKRNWKIGECGILQRETRSLRRSSSPDLSPESSRVSSYDHCLRGD

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
94-232 G3DSA:3.40.50.10140

RNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVA

ProfileScan: PS50104
IPR000157
96-234 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATI

HMMSmart: SM00255
IPR000157
97-234 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATI

HMMPfam: PF01582
IPR000157
100-229 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALE

HMMPanther: PTHR23155
108-1045 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATIAGYHSHSWRNEADMIEKISTDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPHEGFDEIAWEVTCLAGELPLGLKVLGSALRGKSKREWERTLPRLKTSLDGKIGSIIQFSYDVLCDEDKYLFLYIACLFNGESTTKVKELLGKFLDVKQGLHLLAQKSLISFDGERIHMHTLLEQFGRETSRKQFVHHGFTKRQLLVGARGICEVLDDDTTDSRRFIGIHLELSNTEEELNISEKVLERVHDFHFVRIDASFQPERLQLALQDLIYHSPKIRSLNWYGYESLCLPSTFNPEFLVELDMRSSNLRKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLENCSSLEKLPAIENATKLRELKLQNCSSLIELPLSIGTATNLKQLNISGCSSLVKLPSSIGDITDLEVFDLSNCSSLVTLPSSIGNLQNLCKLIMRGCSKLEALPININLKSLDTLNLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSIMSWSPLADFQISYFESLMEFPHAFDIITKLHLSKDIQEVPPWVKRMSRLRDLSLNNCNNLVSLPQLSDSLDYIYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTCIDAMFPGTQVP

HMMPanther: PTHR23155:SF296
108-1045 PTHR23155:SF296

DVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATIAGYHSHSWRNEADMIEKISTDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPHEGFDEIAWEVTCLAGELPLGLKVLGSALRGKSKREWERTLPRLKTSLDGKIGSIIQFSYDVLCDEDKYLFLYIACLFNGESTTKVKELLGKFLDVKQGLHLLAQKSLISFDGERIHMHTLLEQFGRETSRKQFVHHGFTKRQLLVGARGICEVLDDDTTDSRRFIGIHLELSNTEEELNISEKVLERVHDFHFVRIDASFQPERLQLALQDLIYHSPKIRSLNWYGYESLCLPSTFNPEFLVELDMRSSNLRKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLENCSSLEKLPAIENATKLRELKLQNCSSLIELPLSIGTATNLKQLNISGCSSLVKLPSSIGDITDLEVFDLSNCSSLVTLPSSIGNLQNLCKLIMRGCSKLEALPININLKSLDTLNLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSIMSWSPLADFQISYFESLMEFPHAFDIITKLHLSKDIQEVPPWVKRMSRLRDLSLNNCNNLVSLPQLSDSLDYIYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTCIDAMFPGTQVP

superfamily: SSF52540
151-523 SSF52540

SKIAIVLLSRKYASSSWCLDELAEIMKCRQMVGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCRGKPKEQVERWRKALEDVATIAGYHSHSWRNEADMIEKISTDVSNMLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPHEGFDEIAWEVTCLAGELPLGLKVLGSALRGKSKREWERTLPRLKTSLDGKIGSIIQFSYDVLCDEDKYLFL

Gene3D: G3DSA:3.40.50.300
259-419 G3DSA:3.40.50.300

MLNSFTPSRDFDGLVGMRAHMDMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLK

HMMPfam: PF00931
IPR002182
280-535 NB-ARC,NBS
NB-ARC

DMLEQLLRLDLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVEYPSNDEAFQIFCMNAFGQKQPHEGFDEIAWEVTCLAGELPLGLKVLGSALRGKSKREWERTLPRLKTSLDGKIGSIIQFSYDVLCDEDKYLFLYIACLFNGESTT

HMMSmart: SM00382
IPR003593
292-430 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVE

FPrintScan: PR00364
IPR000767
295-310 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
373-387 DISEASERSIST
Disease resistance protein

RLRDKKVFLVLDEVD

FPrintScan: PR00364
IPR000767
466-480 DISEASERSIST
Disease resistance protein

AGELPLGLKVLGSAL

superfamily: SSF46785
501-607 SSF46785

GKIGSIIQFSYDVLCDEDKYLFLYIACLFNGESTTKVKELLGKFLDVKQGLHLLAQKSLISFDGERIHMHTLLEQFGRETSRKQFVHHGFTKRQLLVGARGICEVLD

superfamily: SSF52058
601-1027 SSF52058,LRR

GICEVLDDDTTDSRRFIGIHLELSNTEEELNISEKVLERVHDFHFVRIDASFQPERLQLALQDLIYHSPKIRSLNWYGYESLCLPSTFNPEFLVELDMRSSNLRKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLENCSSLEKLPAIENATKLRELKLQNCSSLIELPLSIGTATNLKQLNISGCSSLVKLPSSIGDITDLEVFDLSNCSSLVTLPSSIGNLQNLCKLIMRGCSKLEALPININLKSLDTLNLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSIMSWSPLADFQISYFESLMEFPHAFDIITKLHLSKDIQEVPPWVKRMSRLRDLSLNNCNNLVSLPQLSDSLDYIYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEAR

Gene3D: G3DSA:3.80.10.10
683-787 G3DSA:3.80.10.10

CLPSTFNPEFLVELDMRSSNLRKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLENCSSLEKLPAIENATKLR

HMMPfam: PF07725
IPR011713
692-711 LRR_3
Leucine-rich repeat 3

FLVELDMRSSNLRKLWEGTK

HMMPfam: PF00560
IPR001611
738-760 LRR_1
Leucine-rich repeat

NLEELKLRNCSSLVELPSSIEKL

FPrintScan: PR00364
IPR000767
758-774 DISEASERSIST
Disease resistance protein

EKLTSLQILDLENCSSL

Gene3D: G3DSA:3.80.10.10
788-1008 G3DSA:3.80.10.10

ELKLQNCSSLIELPLSIGTATNLKQLNISGCSSLVKLPSSIGDITDLEVFDLSNCSSLVTLPSSIGNLQNLCKLIMRGCSKLEALPININLKSLDTLNLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSIMSWSPLADFQISYFESLMEFPHAFDIITKLHLSKDIQEVPPWVKRMSRLRDLSLNNCNNLVSLPQLSDSLDYIYADNCKSLERLDCCFN

HMMPfam: PF00560
IPR001611
809-828 LRR_1
Leucine-rich repeat

NLKQLNISGCSSLVKLPSSI

HMMPfam: PF00560
IPR001611
834-855 LRR_1
Leucine-rich repeat

LEVFDLSNCSSLVTLPSSIGNL

HMMPfam: PF13504
966-983 LRR_7,Leucine rich repeat

SRLRDLSLNNCNNLVSLP


Diseases

Disease Pathogen Avirulence gene
Downy mildew




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox