PRGDB00050963 (RRS1)

From PRG Wiki
Jump to: navigation, search
RRS1
Gene Type Reference_R-Genes,_manually_curated
GenBank 145334738 (NM_001085246)
Gene Class TNL
Domain Type LRR, LRR, NBS, Others
Chromosome 5
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RRS1 (RESISTANT TO RALSTONIA SOLANACEARUM 1) (RRS1) mRNA, complete cds.

DNA Sequence

ATGACCAATTGTGAAAAGGATGAGGAATTCGTGTGCATCAGCTGCGTAGAAGAGGTACGGTACTCTTTCGTGAGCCACCTCTCTGAAGCTCTCCGTCGAAAAGGCATAAATAATGTGGTCGTAGATGTAGATATCGATGATCTGCTTTTCAAGGAGTCTCAGGCAAAGATCGAGAAAGCTGGGGTTTCTGTGATGGTTTTACCCGGAAACTGTGATCCTTCCGAGGTATGGCTTGACAAGTTCGCCAAGGTTCTCGAGTGCCAAAGGAACAACAAGGACCAGGCGGTGGTTTCAGTGTTGTACGGTGACAGTCTATTACGGGACCAATGGCTTAGCGAGCTGGATTTCAGAGGCTTATCACGAATTCACCAATCCAGGAAGGAATGTAGTGACTCTATACTTGTAGAAGAGATTGTGAGAGATGTGTACGAGACGCACTTTTATGTTGGACGAATTGGAATCTATTCGAAGCTGCTGGAGATTGAAAACATGGTTAACAAGCAACCGATAGGCATCCGTTGTGTTGGAATTTGGGGTATGCCTGGCATAGGAAAGACAACACTTGCTAAAGCAGTCTTTGACCAAATGTCTAGCGCCTTTGATGCTTCTTGTTTTATCGAAGACTATGACAAATCAATTCATGAGAAGGGTCTTTATTGTTTGCTGGAGGAACAACTTTTGCCGGGCAATGATGCAACCATTATGAAACTGAGCTCGCTCAGAGACAGATTGAACAGTAAGAGAGTTCTTGTTGTTCTCGATGACGTGCGCAATGCTCTGGTTGGGGAGTCCTTTCTCGAGGGGTTTGACTGGCTAGGACCCGGAAGCCTGATCATCATAACCTCTAGAGATAAACAAGTGTTTTGCCTTTGCGGAATCAATCAAATATATGAGGTCCAGGGTTTAAATGAGAAAGAGGCTCGTCAACTTTTCTTGCTGTCTGCGTCTATAAAGGAGGATATGGGAGAGCAGAATCTCCAGGAGTTGTCAGTGAGAGTAATAAATTATGCTAATGGAAACCCGTTAGCTATCAGTGTTTATGGAAGAGAGCTGAAAGGTAAGAAAAAACTCTCAGAAATGGAGACTGCATTCCTCAAACTCAAGCGACGTCCTCCATTTAAGATTGTCGATGCATTTAAAAGCACCTATGACACACTCAGTGACAACGAAAAGAACATTTTTTTGGACATAGCTTGTTTCTTCCAGGGAGAAAATGTCAACTACGTGATACAACTGCTTGAGGGTTGTGGTTTCTTTCCACATGTTGAAATTGATGTCCTTGTTGACAAGTGTCTGGTAACTATTTCAGAAAACCGAGTTTGGTTGCATAAGCTGACCCAGGATATCGGCCGAGAAATCATAAATGGAGAAACAGTACAGATCGAGAGGCGCAGAAGACTGTGGGAACCTTGGAGCATCAAATATTTATTAGAATATAATGAACACAAAGCAAATGGAGAACCTAAAACAACCTTCAAACGTGCTCAGGGCTCTGAAGAGATCGAAGGCCTGTTTCTAGACACATCAAACTTAAGATTTGATCTGCAGCCCTCTGCCTTTAAGAATATGTTGAACCTTAGATTGCTCAAAATTTATTGTTCCAATCCTGAAGTCCATCCTGTAATCAATTTCCCAACAGGCTCTCTGCATTCTCTTCCTAATGAGCTAAGACTCCTCCATTGGGAGAACTATCCTCTGAAATCTTTGCCTCAGAATTTTGATCCAAGGCACCTTGTCGAAATCAACATGCCGTATAGTCAACTTCAGAAACTTTGGGGTGGAACCAAGAACCTGGAGATGTTGAGGACGATCAGGCTTTGCCATTCCCACCATCTAGTTGATATCGATGATCTCTTAAAAGCTGAAAATCTTGAGGTAATTGATCTCCAAGGTTGTACGAGACTGCAGAATTTCCCAGCCGCAGGTCGATTGCTACGTCTACGAGTTGTAAATCTCTCAGGTTGCATAAAGATTAAAAGTGTCCTAGAAATTCCACCAAATATTGAGAAACTACATCTACAGGGAACTGGCATATTAGCATTACCAGTTTCCACTGTTAAGCCAAACCATAGAGAGCTTGTGAATTTTCTAACAGAAATTCCGGGTCTTTCAGAGGAACTTGAGCGTTTAACAAGTCTGCTGGAATCTAACTCATCTTGTCAAGATCTTGGGAAGCTTATTTGCTTGGAGCTGAAAGATTGCTCTTGTTTGCAGAGTCTGCCAAACATGGCTAATTTAGATCTTAATGTTCTTGATCTCTCGGGTTGCTCAAGTCTTAATTCTATTCAGGGTTTCCCTCGTTTTCTGAAACAGTTATATCTTGGTGGCACTGCAATAAGAGAAGTGCCACAACTTCCTCAAAGTCTAGAAATCTTGAATGCACATGGATCTTGTTTGCGAAGTCTGCCAAACATGGCTAATTTAGAATTTCTCAAAGTTCTTGATCTCTCTGGTTGCTCAGAGCTCGAGACTATTCAGGGTTTTCCTCGGAACCTAAAAGAGTTATATTTTGCTGGCACTACGTTAAGAGAAGTGCCCCAACTTCCTTTAAGCCTAGAGGTCTTGAATGCACATGGTTCTGACTCGGAGAAGCTTCCTATGCATTACAAGTTCAACAATTTTTTCGATCTATCTCAACAAGTGGTCAACGATTTTTTATTGAAAACGCTGACTTATGTAAAACACATACCAAGAGGGTATACGCAGGAACTCATCAACAAAGCTCCGACTTTCAGCTTCAGTGCGCCCTCACATACAAATCAAAACGCCACATTTGATCTGCAATCAGGATCTTCTGTAATGACACGACTAAATCATTCATGGAGGAACACGCTTGTGGGATTTGGTATGCTGGTGGAAGTTGCATTTCCCGAGGACTACTGTGATGCTACAGATGTTGGCATAAGTTGTGTTTGCAGATGGAGCAACAAAGAAGGCCGCTCTTGTAGGATAGAAAGAAAATTTCATTGTTGGGCACCATGGCAAGTTGTTCCAAAAGTTCGAAAGGATCATACGTTTGTCTTTAGTGATGTCAACATGCGCCCAAGTACCGGTGAAGGAAATGACCCTGATATCTGGGCTGGATTAGTTGTATTTGAGTTCTTTCCTATCAATCAGCAGACAAAGTGTCTAAATGATAGGTTCACAGTGAGAAGATGTGGAGTCCGTGTAATAAATGTTGCAACTGGCAATACAAGTCTTGAGAACATAGCACTAGTTTTGTCTTTGGATCCAGTAGAGGTTTCCGGTTATGAAGTATTGAGAGTCAGCTATGATGATTTACAGGAGATGGATAAAGTTCTATTTCTTTACATAGCGTCTTTGTTCAATGACGAGGATGTTGATTTTGTGGCACCACTTATTGCCGGTATTGACTTGGATGTTAGCTCTGGGCTCAAGGTCTTAGCCGATGTGTCTCTCATAAGTGTATCATCAAATGGGGAAATAGTGATGCATAGTTTGCAAAGACAAATGGGTAAAGAAATCCTCCATGGACAATCCATGCTGCTGTCTGATTGTGAGAGTTCCATGACCGAGAATTTGTCTGACGTACCAAAAAAGTAA


Protein sequences

Name Description Sequence
RRS1 (RESISTANT TO RALSTONIA SOLANACEARUM 1) RRS1 (RESISTANT TO RALSTONIA SOLANACEARUM 1) [Arabidopsis thaliana].

MTNCEKDEEFVCISCVEEVRYSFVSHLSEALRRKGINNVVVDVDIDDLLFKESQAKIEKAGVSVMVLPGNCDPSEVWLDKFAKVLECQRNNKDQAVVSVLYGDSLLRDQWLSELDFRGLSRIHQSRKECSDSILVEEIVRDVYETHFYVGRIGIYSKLLEIENMVNKQPIGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLSSLRDRLNSKRVLVVLDDVRNALVGESFLEGFDWLGPGSLIIITSRDKQVFCLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLQELSVRVINYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKIVDAFKSTYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPHVEIDVLVDKCLVTISENRVWLHKLTQDIGREIINGETVQIERRRRLWEPWSIKYLLEYNEHKANGEPKTTFKRAQGSEEIEGLFLDTSNLRFDLQPSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSHHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLSEELERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGCSSLNSIQGFPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHGSDSEKLPMHYKFNNFFDLSQQVVNDFLLKTLTYVKHIPRGYTQELINKAPTFSFSAPSHTNQNATFDLQSGSSVMTRLNHSWRNTLVGFGMLVEVAFPEDYCDATDVGISCVCRWSNKEGRSCRIERKFHCWAPWQVVPKVRKDHTFVFSDVNMRPSTGEGNDPDIWAGLVVFEFFPINQQTKCLNDRFTVRRCGVRVINVATGNTSLENIALVLSLDPVEVSGYEVLRVSYDDLQEMDKVLFLYIASLFNDEDVDFVAPLIAGIDLDVSSGLKVLADVSLISVSSNGEIVMHSLQRQMGKEILHGQSMLLSDCESSMTENLSDVPKK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-1184 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MTNCEKDEEFVCISCVEEVRYSFVSHLSEALRRKGINNVVVDVDIDDLLFKESQAKIEKAGVSVMVLPGNCDPSEVWLDKFAKVLECQRNNKDQAVVSVLYGDSLLRDQWLSELDFRGLSRIHQSRKECSDSILVEEIVRDVYETHFYVGRIGIYSKLLEIENMVNKQPIGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLSSLRDRLNSKRVLVVLDDVRNALVGESFLEGFDWLGPGSLIIITSRDKQVFCLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLQELSVRVINYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKIVDAFKSTYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPHVEIDVLVDKCLVTISENRVWLHKLTQDIGREIINGETVQIERRRRLWEPWSIKYLLEYNEHKANGEPKTTFKRAQGSEEIEGLFLDTSNLRFDLQPSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSHHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLSEELERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGCSSLNSIQGFPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHGSDSEKLPMHYKFNNFFDLSQQVVNDFLLKTLTYVKHIPRGYTQELINKAPTFSFSAPSHTNQNATFDLQSGSSVMTRLNHSWRNTLVGFGMLVEVAFPEDYCDATDVGISCVCRWSNKEGRSCRIERKFHCWAPWQVVPKVRKDHTFVFSDVNMRPSTGEGNDPDIWAGLVVFEFFPINQQTKCLNDRFTVRRCGVRVINVATGNTSLENIALVLSLDPVEVSGYEVLRVSYDDLQEMDKVLFLYIASLFNDEDVDFVAPLIAGIDLDVSSGLKVLADVSLISVSSNGEIVMHSLQRQMGKEILHGQSMLLSDCESSMTENLSDV

HMMPanther: PTHR11017:SF20
1-1184 PTHR11017:SF20,SUBFAMILY NOT NAMED

MTNCEKDEEFVCISCVEEVRYSFVSHLSEALRRKGINNVVVDVDIDDLLFKESQAKIEKAGVSVMVLPGNCDPSEVWLDKFAKVLECQRNNKDQAVVSVLYGDSLLRDQWLSELDFRGLSRIHQSRKECSDSILVEEIVRDVYETHFYVGRIGIYSKLLEIENMVNKQPIGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLSSLRDRLNSKRVLVVLDDVRNALVGESFLEGFDWLGPGSLIIITSRDKQVFCLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLQELSVRVINYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKIVDAFKSTYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPHVEIDVLVDKCLVTISENRVWLHKLTQDIGREIINGETVQIERRRRLWEPWSIKYLLEYNEHKANGEPKTTFKRAQGSEEIEGLFLDTSNLRFDLQPSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSHHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLSEELERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGCSSLNSIQGFPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHGSDSEKLPMHYKFNNFFDLSQQVVNDFLLKTLTYVKHIPRGYTQELINKAPTFSFSAPSHTNQNATFDLQSGSSVMTRLNHSWRNTLVGFGMLVEVAFPEDYCDATDVGISCVCRWSNKEGRSCRIERKFHCWAPWQVVPKVRKDHTFVFSDVNMRPSTGEGNDPDIWAGLVVFEFFPINQQTKCLNDRFTVRRCGVRVINVATGNTSLENIALVLSLDPVEVSGYEVLRVSYDDLQEMDKVLFLYIASLFNDEDVDFVAPLIAGIDLDVSSGLKVLADVSLISVSSNGEIVMHSLQRQMGKEILHGQSMLLSDCESSMTENLSDV

superfamily: SSF52540
170-375 SSF52540

IGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLSSLRDRLNSKRVLVVLDDVRNALVGESFLEGFDWLGPGSLIIITSRDKQVFCLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLQELSVRVINYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKI

HMMPfam: PF00931
IPR002182
170-421 NB-ARC,NBS
NB-ARC

IGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLSSLRDRLNSKRVLVVLDDVRNALVGESFLEGFDWLGPGSLIIITSRDKQVFCLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLQELSVRVINYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKIVDAFKSTYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPH

Gene3D: G3DSA:3.40.50.300
173-187 G3DSA:3.40.50.300

RCVGIWGMPGIGKTT

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

CVGIWGMPGIGKTTLA

Gene3D: G3DSA:3.40.50.300
188-230 G3DSA:3.40.50.300

LAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGN

Gene3D: G3DSA:3.40.50.300
234-310 G3DSA:3.40.50.300

IMKLSSLRDRLNSKRVLVVLDDVRNALVGESFLEGFDWLGPGSLIIITSRDKQVFCLCGINQIYEVQGLNEKEARQL

FPrintScan: PR00364
IPR000767
243-257 DISEASERSIST
Disease resistance protein

RLNSKRVLVVLDDVR

FPrintScan: PR00364
IPR000767
337-351 DISEASERSIST
Disease resistance protein

ANGNPLAISVYGREL

superfamily: SSF46785
373-478 SSF46785

FKIVDAFKSTYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPHVEIDVLVDKCLVTISENRVWLHKLTQDIGREIINGETVQIERRRRLWEPWSIKYLLE

Gene3D: G3DSA:3.80.10.10
499-756 G3DSA:3.80.10.10

EEIEGLFLDTSNLRFDLQPSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSHHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLSEELERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGC

superfamily: SSF52058
517-879 SSF52058,LRR

PSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSHHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLSEELERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGCSSLNSIQGFPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHGSDSEKLPMHYKFNNFFDLSQ

HMMPfam: PF07725
IPR011713
577-596 LRR_3
Leucine-rich repeat 3

HLVEINMPYSQLQKLWGGTK

Gene3D: G3DSA:3.80.10.10
765-859 G3DSA:3.80.10.10

FPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHG

FPrintScan: PR00364
IPR000767
806-822 DISEASERSIST
Disease resistance protein

ANLEFLKVLDLSGCSEL

superfamily: SSF46785
1081-1169 SSF46785

VSGYEVLRVSYDDLQEMDKVLFLYIASLFNDEDVDFVAPLIAGIDLDVSSGLKVLADVSLISVSSNGEIVMHSLQRQMGKEILHGQSML


Diseases

Disease Pathogen Avirulence gene
Bacterial Wilt (Arabidopsis) Ralstonia solanacearum




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox