PRGDB00050964 (RTM1)

From PRG Wiki
Jump to: navigation, search
RTM1
Gene Type Reference_R-Genes,_manually_curated
GenBank 30679421 (NM_100456)
Gene Class Other
Domain Type
Chromosome 1
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RTM1 (RESTRICTED TEV MOVEMENT 1) (RTM1) mRNA, complete cds.

DNA Sequence

ATGAAGATAGGACCTGTAGGGAAGCATGATGCTAGAAGCACTACAATTGTAAACTGGGACGAAGGATCTCACGATGGCTTCATCTCTCAGATTTTTCTATCTCATGGCGTCGCTGGAATTATGTCTATCCAATTCCAGTTCGTGATGGACGGAAAACTCGTTTTATCCGATCGTCACGGTCCATTTTCCGGCAACATGTTTGACGTTATAGAGCTCAACTATCCGCATGAGTACATAACTGGAATCAGTGGAGAGTATTACAAGTATGAAGCCAACAATCCTCACATGAGGTCTCTCAAATTCAATACCAACACTAGCGAGTACGGTCCTTTTGGCACCTCCGGTTCGAGCAACGACAAATTTGCTTTTAAACTCGGGAAATCTCCTCAGTTCGGCGGTTTCCATGGGACTTATGATGCCTCGGGACTACAGTACATTGGTGTTTATCTCCGCCCAAAAACAGTTCTACCCAAAATAGATACGGGCAATGCAGAGGAAACAGAGTCAAAAATTGTACTGGGCTGA


Protein sequences

Name Description Sequence
RTM1 (RESTRICTED TEV MOVEMENT 1) RTM1 (RESTRICTED TEV MOVEMENT 1) [Arabidopsis thaliana].

MKIGPVGKHDARSTTIVNWDEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRPKTVLPKIDTGNAEETESKIVLG

Domains

Domain Start-End Description Sequence

superfamily: SSF51101
IPR001229
1-152 Mannose-bd_lectin
Mannose-binding lectin

MKIGPVGKHDARSTTIVNWDEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRP

Gene3D: G3DSA:2.100.10.30
IPR001229
2-152 Mannose-bd_lectin
Mannose-binding lectin

KIGPVGKHDARSTTIVNWDEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRP

HMMSmart: SM00915
IPR001229
16-152 Jacalin
Mannose-binding lectin

IVNWDEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRP

HMMPfam: PF01419
IPR001229
18-152 Jacalin
Mannose-binding lectin

NWDEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRP


Diseases

Disease Pathogen Avirulence gene
Synergistic Disease Syndromes Tobacco etch virus




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox