PRGDB00050965 (RTM2)

From PRG Wiki
Jump to: navigation, search
RTM2
Gene Type Reference_R-Genes,_manually_curated
GenBank 30680686 (NM_120571)
Gene Class Other
Domain Type
Chromosome 5
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RTM2 (RESTRICTED TEV MOVEMENT 2) (RTM2) mRNA, complete cds.

DNA Sequence

ATGGCAGCGAGACAGCAACAAAAAGGAACAGGCTTCGGGGTTCAATACGAGGACTTTGTCCCCAAATCCGAATGGAAAGATCAACCTGAAGCCACCATTCTCAACATTGACCTAACAGGTTTTGCAAAGGAGCAAATGAAAGTGACGTATGTGCACAGCTCGAAGATGATAAGAGTCACTGGAGAACGTCCCTTGGCTAATCGGAAATGGAGCCGTTTCAACGAGGTGTTCACTGTTCCACAGAATTGTTTAGTGGATAAGATCCATGGGAGCTTTAAGAACAATGTCCTCACCATCACCATGCCTAAGGAGACGATCACGAAGGTGGCTTATCTTCCAGAAACTTCTAGAACTGAAGCTGCTGCTCTGGAGAAGGCGGCGAAGCTAGAGGAGAAGAGATTGTTAGAAGAATCTAGAAGGAAAGAGAAGGAAGAAGAAGAAGCTAAGCAGATGAAGAAGCAGCTTCTGGAAGAGAAAGAGGCGCTAATTAGGAAGCTGCAAGAAGAAGCTAAAGCAAAGGAAGAGGCTGAAATGAGGAAGCTTCAAGAAGAAGCTAAAGCAAAGGAGGAGGCCGCGGCAAAGAAGCTTCAAGAAGAAATTGAAGCAAAAGAGAAACTTGAGGAGAGAAAGCTCGAGGAAAGGAGACTTGAGGAGAGGAAGCTCGAGGATATGAAGCTTGCGGAAGAAGCTAAACTAAAGAAGATCCAGGAGAGAAAGTCTGTTGATGAATCTGGAGAAAAAGAGAAGATACTAAAGCCAGAAGTGGTCTATACAAAATCCGGGCACGTGGCTACTCCCAAACCTGAGTCGGGGTCTGGTCTCAAGTCCGGGTTTGGAGGAGTAGGCGAGGTGGTGAAGTCAGCGGAAGAAAAACTAGGAAACTTGGTGGAAAAGGAAAAGAAAATGGGGAAAGGGATAATGGAGAAAATAAGAAGGAAAGAGATAACAAGTGAAGAGAAGAAGTTGATGATGAATGTAGGAGTGGCTGCTCTTGTTATCTTTGCTCTCGGAGCTTATGTTTCTTATACCTTCTGCTCTTCTTCTTCTTCTTCTTCCTCTTCGTCTCCTTCTTCATCATCATCTTCTACCAAACCAGAATGA


Protein sequences

Name Description Sequence
RTM2 (RESTRICTED TEV MOVEMENT 2) RTM2 (RESTRICTED TEV MOVEMENT 2) [Arabidopsis thaliana].

MAARQQQKGTGFGVQYEDFVPKSEWKDQPEATILNIDLTGFAKEQMKVTYVHSSKMIRVTGERPLANRKWSRFNEVFTVPQNCLVDKIHGSFKNNVLTITMPKETITKVAYLPETSRTEAAALEKAAKLEEKRLLEESRRKEKEEEEAKQMKKQLLEEKEALIRKLQEEAKAKEEAEMRKLQEEAKAKEEAAAKKLQEEIEAKEKLEERKLEERRLEERKLEDMKLAEEAKLKKIQERKSVDESGEKEKILKPEVVYTKSGHVATPKPESGSGLKSGFGGVGEVVKSAEEKLGNLVEKEKKMGKGIMEKIRRKEITSEEKKLMMNVGVAALVIFALGAYVSYTFCSSSSSSSSSSPSSSSSSTKPE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11527
12-212 PTHR11527,SMALL HEAT-SHOCK PROTEIN (HSP20) FAMILY

FGVQYEDFVPKSEWKDQPEATILNIDLTGFAKEQMKVTYVHSSKMIRVTGERPLANRKWSRFNEVFTVPQNCLVDKIHGSFKNNVLTITMPKETITKVAYLPETSRTEAAALEKAAKLEEKRLLEESRRKEKEEEEAKQMKKQLLEEKEALIRKLQEEAKAKEEAEMRKLQEEAKAKEEAAAKKLQEEIEAKEKLEERKLE

HMMPanther: PTHR11527:SF45
12-212 PTHR11527:SF45,RTM2 (RESTRICTED TEV MOVEMENT 2)

FGVQYEDFVPKSEWKDQPEATILNIDLTGFAKEQMKVTYVHSSKMIRVTGERPLANRKWSRFNEVFTVPQNCLVDKIHGSFKNNVLTITMPKETITKVAYLPETSRTEAAALEKAAKLEEKRLLEESRRKEKEEEEAKQMKKQLLEEKEALIRKLQEEAKAKEEAEMRKLQEEAKAKEEAAAKKLQEEIEAKEKLEERKLE

Gene3D: G3DSA:2.60.40.790
15-107 G3DSA:2.60.40.790

QYEDFVPKSEWKDQPEATILNIDLTGFAKEQMKVTYVHSSKMIRVTGERPLANRKWSRFNEVFTVPQNCLVDKIHGSFKNNVLTITMPKETIT

superfamily: SSF49764
IPR008978
19-108 HSP20_chap
HSP20-like chaperone

FVPKSEWKDQPEATILNIDLTGFAKEQMKVTYVHSSKMIRVTGERPLANRKWSRFNEVFTVPQNCLVDKIHGSFKNNVLTITMPKETITK

ProfileScan: PS01031
IPR002068
24-103 HSP20
Heat shock protein Hsp20

EWKDQPEATILNIDLTGFAKEQMKVTYVHSSKMIRVTGERPLANRKWSRFNEVFTVPQNCLVDKIHGSFKNNVLTITMPK

HMMPfam: PF00011
IPR002068
24-105 HSP20
Heat shock protein Hsp20

EWKDQPEATILNIDLTGFAKEQMKVTYVHSSKMIRVTGERPLANRKWSRFNEVFTVPQNCLVDKIHGSFKNNVLTITMPKET


Diseases

Disease Pathogen Avirulence gene
Synergistic Disease Syndromes Tobacco etch virus




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox