PRGDB00061432 (MLA1)

From PRG Wiki
Jump to: navigation, search
MLA1
Gene Type Reference_R-Genes,_manually_curated
GenBank 270267804 (GU245961)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare MLA1 mRNA, complete cds.

DNA Sequence

ATGGAGGTCGTCACGGGTGCCATGGGCAGCCTGCTCCCCAAGCTGGGCCAACTGCTCCTCGATGAGTACAACTTGCACAAGCGCGTCAAGAAAGATGTCGAGTTCCTCACGAAGGAGCTTGAGAGCATGCACGCTGCCCTCATCAAGGTTGGCAAGGTGCCACGGGACCATCTCGACAGGCAAGTAAAGCTCTGGGCCGACGAGGTCAGAGAGCTCTCCTACAACATGGAGGATGTCGTTGACAAGTTCCTCGTGCGCGTCGACGGCAACTCCGGCAGATTCAAGGAGCTCAAGAACAAGATGATCGGCTTGTTCAAGAAAGGCAAGAATCACCATCGGATAGCTGACGCGATCAAGGAAATCAAGGAGCAACTCCAGGAGGTGGCTGCTAGGCGTGACAGGAACGAGGTACTTGTTCCTAATCCTATGGAACCAATTGCTATCGATCCTTGTCTTCGAGCTTTGTACGCAGAAGCGTCGGAGCTAGTTGGCATATATGGCAAGAGGGATCAGGAGCTCATGAGGTTGCTCTCCATGGAGGGTGATGATGCCTCTGAGAAGAGACTGAAGAAGGTCTCCATTGTTGGATTTGGAGGGTTGGGCAAGACCACTCTTGCAAGAGCAGTATACGACAAGATTAAAGGTGATTTCGATTGTGGGGCATTTGTTCCGGTCGGTCAGAACCCTGACATGAAGAAGGTTTTAAGGGATATCCTCATTGATCTCGGTAACCCTCTCTCGGACCTTGCGATGCTGGATGCCAATCAGCTTATTAAAAAGCTTCGTGATTTTCTAGAGAACAAAAGGTATCTTGTCATAATTGATGATATATGGGATGACAAATTGTGGGAAGCCATCAACTTTGCTTTCTCCAAGAGGAATAATCTAGGCAGTCGGCTAATCATCACAACCCGCATTGTTAGTGTCTCCAATTCATGTTGTTCGTCAGCTCATGATTCAGTTTATCAAATGAAACCTCTTTCTACTGATGACTCCAGAAGGCTCTTCCATAAAAGAATATTTCCGGACGATAGTGGATGTCCAAATGAATTTGAACAAGTGTCAGAAGATTTATTGAAAAAATGTGGTGGGGTACCGCTAGCCATCATTACTATTGCTAGTGCTTTGGCTGGTGGCCAGCAGATGAAACCAAAGTGTGAGTGGGATATTTTACTCCAGTCCCTTGGCTCTGGACTAACAGAAGATAACAGTTTAGAGGAGATGCGGAGGATACTATCTTTCAGCTATTATGATCTACCTTATCATCTGAGAACTTGTCTATTGTACCTATGTATATACCCAGAAGACAGCCAGATTGATAGAGATAGACTGATATGGAAGTGGGTGGCTGAAGGATTTGTCCACTGTGGAAACCAAGGGACTAGCCTATTTTTGCTCGGATTAAACTACTTCAACCAGCTCATTAACAGAAGTATGATCCAGCCAATATATGGTTATGCAGGTGAGGTATATGCTTGTTGTGTACATGATATGGTTCTTGATCTTATCTGCAACTTGTCACATGAAGCAAAGTTTGTTAATGTATTGGATGGCACTGGGGATAGCATGTCCTTACAAGGCAATGTTCGTCGTTTGTCCCTTCAACATAGAAACAAAGATCATCAAGGCACACCTCTCAGAAATTTCAGGGGTATATCACGAGTGAGGTCCATTACTAATTTTGGATCTGCTATTAATATCATGCCAGTCCTGTCAAGGTTTGAAGTTCTGCGTGTACTTGATTTGACGGACTGTAATCTGGGAGAAAGTAGCAGCCTGCAACTTAACCTCAAGGGTTTTGGACACTTAATTCACCTGAGGTACCTTGGTCTAGCAGGTACTGGAATCATGAAACTATCAGCTGAGATAGGAAATCTGCAGTTTTTGGAGGTCTTGGATCTAGGAGGCAACAATGGGCTAGAAGAATTGCCACCCATTGTTTATAATTTGAGAAGATTAATCTACCTAAATGTTCCCTTTATGGTGGTTCCAGCTGGTGTGTTGCAGAATCTGACATCCATAGAAGTGTTGAGGGGAATATTGGTCTCTTTGAACACTGTCGCACAAGAGCTTGGCAACATAGCAATGCTGAGGGAGCTTGAGATTTGCTTCAAGGAGGGTAGTTTGGCTTTGTATGAATGTTTTGTGAAGTCTCTTTGCAGCCTACATCAGATCGAAAGTCTATGTATTGATTGCAATCCCAGAGAAACATCATCTTTTGAACTGATGGATCTCTTGGGAGAACGCTGGGTGCCTCCTGTACATATCCGCAAATTTGACTCAAGCTTTCCCAGCCAACTCTCTGCACTGCGAGGGTGGATAAAGAAAGACCCCTCGCATCTCTCGAACCTCTCCGATTTATTCCTCAGACCAGTGAAGGAAGTGCAGCAGGAGGACGTGGAAATCATTGGGGGGCTGTTGTCCCTTCGCCGTCTCTGGATAAAGAGCACCCACCAAACACAACGGCTGCTAGATGGGTTCCGCTGTCTGTTACGCTTTTCCTTGGATTGTGGATCAGCAGCGCAGATAATGTTTGAACCAGGAGCATTGCCGAGGGTGGAAATAGTTATATTCAGTCTGGGCGTGCGGGTGGCGAAAGAGGATGGTAACTGTCGCTTCGACTTGGGCCTGCAGGGGAACCTGCTCTCCCTTCGGCAACGTGTCTGGGTTAAAATCTATTGTGGTGGAGCGACGGTGGGTGAGGCAAAGGAAGCGGAGGCTGCGGTGCGGCTCGCGCTCGACTCCCATCCCAACCATCCCCCGATTTATATTGAGATGAGGCCGCGTATACAAGAAGATGCGCACGATGACGATTTGTGTAAGGACATGACGGAGAACTGA


Protein sequences

Name Description Sequence
MLA1 MLA1 [Hordeum vulgare].

MEVVTGAMGSLLPKLGQLLLDEYNLHKRVKKDVEFLTKELESMHAALIKVGKVPRDHLDRQVKLWADEVRELSYNMEDVVDKFLVRVDGNSGRFKELKNKMIGLFKKGKNHHRIADAIKEIKEQLQEVAARRDRNEVLVPNPMEPIAIDPCLRALYAEASELVGIYGKRDQELMRLLSMEGDDASEKRLKKVSIVGFGGLGKTTLARAVYDKIKGDFDCGAFVPVGQNPDMKKVLRDILIDLGNPLSDLAMLDANQLIKKLRDFLENKRYLVIIDDIWDDKLWEAINFAFSKRNNLGSRLIITTRIVSVSNSCCSSAHDSVYQMKPLSTDDSRRLFHKRIFPDDSGCPNEFEQVSEDLLKKCGGVPLAIITIASALAGGQQMKPKCEWDILLQSLGSGLTEDNSLEEMRRILSFSYYDLPYHLRTCLLYLCIYPEDSQIDRDRLIWKWVAEGFVHCGNQGTSLFLLGLNYFNQLINRSMIQPIYGYAGEVYACCVHDMVLDLICNLSHEAKFVNVLDGTGDSMSLQGNVRRLSLQHRNKDHQGTPLRNFRGISRVRSITNFGSAINIMPVLSRFEVLRVLDLTDCNLGESSSLQLNLKGFGHLIHLRYLGLAGTGIMKLSAEIGNLQFLEVLDLGGNNGLEELPPIVYNLRRLIYLNVPFMVVPAGVLQNLTSIEVLRGILVSLNTVAQELGNIAMLRELEICFKEGSLALYECFVKSLCSLHQIESLCIDCNPRETSSFELMDLLGERWVPPVHIRKFDSSFPSQLSALRGWIKKDPSHLSNLSDLFLRPVKEVQQEDVEIIGGLLSLRRLWIKSTHQTQRLLDGFRCLLRFSLDCGSAAQIMFEPGALPRVEIVIFSLGVRVAKEDGNCRFDLGLQGNLLSLRQRVWVKIYCGGATVGEAKEAEAAVRLALDSHPNHPPIYIEMRPRIQEDAHDDDLCKDMTEN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF217
4-937 PTHR23155:SF217,OS11G0657900 PROTEIN

VTGAMGSLLPKLGQLLLDEYNLHKRVKKDVEFLTKELESMHAALIKVGKVPRDHLDRQVKLWADEVRELSYNMEDVVDKFLVRVDGNSGRFKELKNKMIGLFKKGKNHHRIADAIKEIKEQLQEVAARRDRNEVLVPNPMEPIAIDPCLRALYAEASELVGIYGKRDQELMRLLSMEGDDASEKRLKKVSIVGFGGLGKTTLARAVYDKIKGDFDCGAFVPVGQNPDMKKVLRDILIDLGNPLSDLAMLDANQLIKKLRDFLENKRYLVIIDDIWDDKLWEAINFAFSKRNNLGSRLIITTRIVSVSNSCCSSAHDSVYQMKPLSTDDSRRLFHKRIFPDDSGCPNEFEQVSEDLLKKCGGVPLAIITIASALAGGQQMKPKCEWDILLQSLGSGLTEDNSLEEMRRILSFSYYDLPYHLRTCLLYLCIYPEDSQIDRDRLIWKWVAEGFVHCGNQGTSLFLLGLNYFNQLINRSMIQPIYGYAGEVYACCVHDMVLDLICNLSHEAKFVNVLDGTGDSMSLQGNVRRLSLQHRNKDHQGTPLRNFRGISRVRSITNFGSAINIMPVLSRFEVLRVLDLTDCNLGESSSLQLNLKGFGHLIHLRYLGLAGTGIMKLSAEIGNLQFLEVLDLGGNNGLEELPPIVYNLRRLIYLNVPFMVVPAGVLQNLTSIEVLRGILVSLNTVAQELGNIAMLRELEICFKEGSLALYECFVKSLCSLHQIESLCIDCNPRETSSFELMDLLGERWVPPVHIRKFDSSFPSQLSALRGWIKKDPSHLSNLSDLFLRPVKEVQQEDVEIIGGLLSLRRLWIKSTHQTQRLLDGFRCLLRFSLDCGSAAQIMFEPGALPRVEIVIFSLGVRVAKEDGNCRFDLGLQGNLLSLRQRVWVKIYCGGATVGEAKEAEAAVRLALDSHPNHPPIYIEMRPRIQEDAHDD

HMMPanther: PTHR23155
4-937 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTGAMGSLLPKLGQLLLDEYNLHKRVKKDVEFLTKELESMHAALIKVGKVPRDHLDRQVKLWADEVRELSYNMEDVVDKFLVRVDGNSGRFKELKNKMIGLFKKGKNHHRIADAIKEIKEQLQEVAARRDRNEVLVPNPMEPIAIDPCLRALYAEASELVGIYGKRDQELMRLLSMEGDDASEKRLKKVSIVGFGGLGKTTLARAVYDKIKGDFDCGAFVPVGQNPDMKKVLRDILIDLGNPLSDLAMLDANQLIKKLRDFLENKRYLVIIDDIWDDKLWEAINFAFSKRNNLGSRLIITTRIVSVSNSCCSSAHDSVYQMKPLSTDDSRRLFHKRIFPDDSGCPNEFEQVSEDLLKKCGGVPLAIITIASALAGGQQMKPKCEWDILLQSLGSGLTEDNSLEEMRRILSFSYYDLPYHLRTCLLYLCIYPEDSQIDRDRLIWKWVAEGFVHCGNQGTSLFLLGLNYFNQLINRSMIQPIYGYAGEVYACCVHDMVLDLICNLSHEAKFVNVLDGTGDSMSLQGNVRRLSLQHRNKDHQGTPLRNFRGISRVRSITNFGSAINIMPVLSRFEVLRVLDLTDCNLGESSSLQLNLKGFGHLIHLRYLGLAGTGIMKLSAEIGNLQFLEVLDLGGNNGLEELPPIVYNLRRLIYLNVPFMVVPAGVLQNLTSIEVLRGILVSLNTVAQELGNIAMLRELEICFKEGSLALYECFVKSLCSLHQIESLCIDCNPRETSSFELMDLLGERWVPPVHIRKFDSSFPSQLSALRGWIKKDPSHLSNLSDLFLRPVKEVQQEDVEIIGGLLSLRRLWIKSTHQTQRLLDGFRCLLRFSLDCGSAAQIMFEPGALPRVEIVIFSLGVRVAKEDGNCRFDLGLQGNLLSLRQRVWVKIYCGGATVGEAKEAEAAVRLALDSHPNHPPIYIEMRPRIQEDAHDD

superfamily: SSF52540
145-402 SSF52540

PIAIDPCLRALYAEASELVGIYGKRDQELMRLLSMEGDDASEKRLKKVSIVGFGGLGKTTLARAVYDKIKGDFDCGAFVPVGQNPDMKKVLRDILIDLGNPLSDLAMLDANQLIKKLRDFLENKRYLVIIDDIWDDKLWEAINFAFSKRNNLGSRLIITTRIVSVSNSCCSSAHDSVYQMKPLSTDDSRRLFHKRIFPDDSGCPNEFEQVSEDLLKKCGGVPLAIITIASALAGGQQMKPKCEWDILLQSLGSGLTED

Gene3D: G3DSA:3.40.50.300
174-304 G3DSA:3.40.50.300

MRLLSMEGDDASEKRLKKVSIVGFGGLGKTTLARAVYDKIKGDFDCGAFVPVGQNPDMKKVLRDILIDLGNPLSDLAMLDANQLIKKLRDFLENKRYLVIIDDIWDDKLWEAINFAFSKRNNLGSRLIITT

HMMPfam: PF00931
IPR002182
186-457 NB-ARC,NBS
NB-ARC

EKRLKKVSIVGFGGLGKTTLARAVYDKIKGDFDCGAFVPVGQNPDMKKVLRDILIDLGNPLSDLAMLDANQLIKKLRDFLENKRYLVIIDDIWDDKLWEAINFAFSKRNNLGSRLIITTRIVSVSNSCCSSAHDSVYQMKPLSTDDSRRLFHKRIFPDDSGCPNEFEQVSEDLLKKCGGVPLAIITIASALAGGQQMKPKCEWDILLQSLGSGLTEDNSLEEMRRILSFSYYDLPYHLRTCLLYLCIYPEDSQIDRDRLIWKWVAEGFVHCG

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

KVSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
264-278 DISEASERSIST
Disease resistance protein

FLENKRYLVIIDDIW

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

CGGVPLAIITIASAL

superfamily: SSF52047
527-820 SSF52047,LRR

GNVRRLSLQHRNKDHQGTPLRNFRGISRVRSITNFGSAINIMPVLSRFEVLRVLDLTDCNLGESSSLQLNLKGFGHLIHLRYLGLAGTGIMKLSAEIGNLQFLEVLDLGGNNGLEELPPIVYNLRRLIYLNVPFMVVPAGVLQNLTSIEVLRGILVSLNTVAQELGNIAMLRELEICFKEGSLALYECFVKSLCSLHQIESLCIDCNPRETSSFELMDLLGERWVPPVHIRKFDSSFPSQLSALRGWIKKDPSHLSNLSDLFLRPVKEVQQEDVEIIGGLLSLRRLWIKSTHQT

Gene3D: G3DSA:3.80.10.10
553-719 G3DSA:3.80.10.10

SRVRSITNFGSAINIMPVLSRFEVLRVLDLTDCNLGESSSLQLNLKGFGHLIHLRYLGLAGTGIMKLSAEIGNLQFLEVLDLGGNNGLEELPPIVYNLRRLIYLNVPFMVVPAGVLQNLTSIEVLRGILVSLNTVAQELGNIAMLRELEICFKEGSLALYECFVKSL

FPrintScan: PR00364
IPR000767
624-640 DISEASERSIST
Disease resistance protein

GNLQFLEVLDLGGNNGL

HMMPfam: PF00560
IPR001611
629-645 LRR_1
Leucine-rich repeat

LEVLDLGGNNGLEELPP

Gene3D: G3DSA:3.80.10.10
779-818 G3DSA:3.80.10.10

SHLSNLSDLFLRPVKEVQQEDVEIIGGLLSLRRLWIKSTH


Diseases

Disease Pathogen Avirulence gene
Powdery mildew (barley) Blumeria graminis




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox