PRGDB00061435 (MLA13)

From PRG Wiki
Jump to: navigation, search
MLA13
Gene Type Reference_R-Genes,_manually_curated
GenBank 27464252 (AF523683)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Hordeum vulgare

Comment?

Hordeum vulgare CC-NBS-LRR resistance protein MLA13 mRNA, complete cds; alternatively spliced.

DNA Sequence

ATGGATATTGTCACCGGTGCCATTTCCAACCTGATTCCCAAGTTGGGGGAGCTACTCACGGAGGAGTTCAAGCTGCACAAGGGTGTCAAGAAAAATATTGAGGACCTCGGGAAGGAGCTTGAGAGCATGAACGCTGCCCTCATCAAGATTGGTGAGGTGCCGAGGGAGCAGCTCGACAGCCAAGACAAGCTCTGGGCCGATGAGGTCAGAGAGCTCTCCTACGTCATTGAGGATGTCGTCGACAAGTTCCTCGTACAGGTTGATGGCATTAAGTCTGATGATAACAACAACAAATTTAAGGGGCTCATGAAGAGGACTACCGAGTTGTTGAAGAAAGTCAAGCATAAGCATGGGATAGCTCACGCGATCAAGGACATCCAAGAGCAACTCCAAAAGGTGGCTGATAGGCGTGACAGGAACAAGGTATTTGTTCCTCATCCTACGAGAACAATTGCTATTGACCCTTGCCTTCGAGCTTTGTATGCTGAAGCGACAGAGCTAGTTGGCATATATGGAAAGAGGGATCAAGGCCTCATGAGGTTGCTTTCCATGGAGGGCGATGATGCCTCTAATAAGAGACTGAAGAAGGTCTCCATTGTTGGATTTGGAGGGTTGGGCAAGACCACTCTTGCTAGAGCGGTATACGAGAAGATTAAAGGTGATTTCGATTGTCGGGCATTTGTTCCGGTCGGTCAGAACCCTGACATGAAGAAGGTTTTAAGGGATATCCTCATTGATCTCGGAAATCCTCACTCAGATCTTGCGATGCTGGATGCCAATCAGCTTATTAAAAAGCTTCATGAATTTCTAGAGAACAAAAGGTATCTTGTCATAATTGATGATATATGGGATGAAAAATTGTGGGAAGGCATCAACTTTGCTTTCTCCAATAGGAATAATCTAGGCAGTCGGCTAATCACCACAACCCGCATTGTCAGTGTCTCTAATTCATGTTGCTCATCAGATGGTGATTCTGTTTATCAAATGGAACCGCTTTCTGTTGATGACTCCAGAATGCTCTTCTACAAAAGAATATTTCCTGATGAGAATGCATGTATAAATGAATTTGAACAAGTATCCAGAGATATTCTAAAGAAATGTGGTGGGGTACCACTAGCCATAATTACTATAGCTAGTGCTTTGGCTGGTGACCAGAAGATGAAACCAAAATGTGAGTGGGATATTCTCCTTCGGTCCCTTGGCTCTGGACTAACAGAAGATAACAGTTTAGAGGAGATGCGGAGAATACTCTCTTTCAGCTATTCTAATCTACCTTCGAATCTGAAAACTTGTCTACTGTATCTATGTGTATATCCAGAAGATAGTATGATTTCTAGAGATAAACTGATATGGAAGTGGGTGGCCGAAGGATTTGTCCACCATGAAAATCAAGGAAATAGCCTGTATTTGCTCGGATTAAATTACTTCAACCAGCTCATTAATAGAAGTATGATCCAGCCAATATATAATTATAGCGGCGAGGCATATGCTTGCCGTGTACATGATATGGTTCTGGACCTTATCTGCAACTTGTCAAATGAAGCAAAGTTTGTGAATCTATTGGATGGCACTGGGAATAGCATGTCTTCACAGAGTAATTGTCGCCGTTTGTCCCTTCAGAAAAGAAATGAAGATCATCAAGCCAGGCCTTTCACAGATATCAAGAGTATGTCACGAGTGAGGTCAATTACTATCTTTCCATCTGCTATTGAAGTCATGCCATCTCTTTCAAGGTTTGACGTTTTACGTGTACTTGATCTGTCACGATGTAATCTTGGGGAGAATAGCAGCATGCAGCTTAACCTCAAGGGTGTTGGACATTTAACTCACCTAAGGTACCTTGGTCTAGAAGGTACCAACATCAGTAAGCTCCCTGCTGAGATAGGAAAACTGCAGTTTTTGGAGGTGTTGGATCTTGAAAACAATCATAATCTAAAGGAATTGCCGTCCACAGTTTGTAATTTCAGAAGATTAATCTACCTAAATTTAGTTGGCTGTCAGGTGGTTCCTCCAGTTGGTGTGTTGCAAAATCTGACATCCATAGAAGTGTTGAGTGGTATCTTGGTCTCTCTGAACATTATTGCACAAGAGCTTGGCAACTTGAAAAGGCTGAGGGAGCTTAACATTCTCTTCAATGATGGTAGTTTGGATTTGTATGAAGGTTTTGTGAAGTCTCTTTGCAACCTACATCACATCGAAAGCCTAATCATTGGTTGCAATTCTAGAGAAACATCATCTTTTGAACTGATGGATCTCCTGGGGGAACGCTGGGTGCCTCCTGTACATTTCCGTGAATTTGTGTCATCCATGCCTAGCCAACTCTCTGCACTGCGAGGGTGGATAAAGAGAGACCCCTCCCATCTCTCGAACCTCTCCGAGTTAATCCTCACATCAGTGAAGGAGGTGCAGCAGGATGACGTGGTAATCATTGGGGCCTTGTCGTCCCTTCGCCGTCTCTGCATAAAGAGCACCTACCAAACACAACGGCTGCTAGTCATCCCTGCAGATGGGTTCCGCTGTATTGTTGGCTTTCATTTGGATTGTGGATCTGCCACACAGATATTGTTTGAGCCTGGAGCTTTGCCGAGGGCAGAATCAGTTGTGATCAGTCTCGGCGTGCGGGTGGCGAAAGAGGATGGTAACCGTGGCTTCGACTTGGGCCTGCAGGGGAACCTGCTCTCCCTTCGGCGGGATGTCTTTGTTTCTATCTATTGTGGTGGAGCGAGGGTTGGGGAGGCAAAGGAAGCGGAGGCTGCGGTGAGGCGTGCCCTCGACGCCCATCCCAGCCATCCCCCGATTTATTTTGAGATGAGGCCGCATATAGCAAAAGGTGCTCATGATGATGATTTGTGTGAGGAGAGGAGGAGAACTGATTTCTGA


Protein sequences

Name Description Sequence
CC-NBS-LRR resistance protein MLA13 CC-NBS-LRR resistance protein MLA13 [Hordeum vulgare].

MDIVTGAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELESMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVDKFLVQVDGIKSDDNNNKFKGLMKRTTELLKKVKHKHGIAHAIKDIQEQLQKVADRRDRNKVFVPHPTRTIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHENQGNSLYLLGLNYFNQLINRSMIQPIYNYSGEAYACRVHDMVLDLICNLSNEAKFVNLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPFTDIKSMSRVRSITIFPSAIEVMPSLSRFDVLRVLDLSRCNLGENSSMQLNLKGVGHLTHLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNHNLKELPSTVCNFRRLIYLNLVGCQVVPPVGVLQNLTSIEVLSGILVSLNIIAQELGNLKRLRELNILFNDGSLDLYEGFVKSLCNLHHIESLIIGCNSRETSSFELMDLLGERWVPPVHFREFVSSMPSQLSALRGWIKRDPSHLSNLSELILTSVKEVQQDDVVIIGALSSLRRLCIKSTYQTQRLLVIPADGFRCIVGFHLDCGSATQILFEPGALPRAESVVISLGVRVAKEDGNRGFDLGLQGNLLSLRRDVFVSIYCGGARVGEAKEAEAAVRRALDAHPSHPPIYFEMRPHIAKGAHDDDLCEERRRTDF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF217
4-847 PTHR23155:SF217,OS11G0657900 PROTEIN

VTGAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELESMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVDKFLVQVDGIKSDDNNNKFKGLMKRTTELLKKVKHKHGIAHAIKDIQEQLQKVADRRDRNKVFVPHPTRTIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHENQGNSLYLLGLNYFNQLINRSMIQPIYNYSGEAYACRVHDMVLDLICNLSNEAKFVNLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPFTDIKSMSRVRSITIFPSAIEVMPSLSRFDVLRVLDLSRCNLGENSSMQLNLKGVGHLTHLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNHNLKELPSTVCNFRRLIYLNLVGCQVVPPVGVLQNLTSIEVLSGILVSLNIIAQELGNLKRLRELNILFNDGSLDLYEGFVKSLCNLHHIESLIIGCNSRETSSFELMDLLGERWVPPVHFREFVSSMPSQLSALRGWIKRDPSHLSNLSELILTSVKEVQQDDVVIIGALSSLRRLCIKSTYQTQRLLVIPADGFRCIVGFHLD

HMMPanther: PTHR23155
4-847 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTGAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELESMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVDKFLVQVDGIKSDDNNNKFKGLMKRTTELLKKVKHKHGIAHAIKDIQEQLQKVADRRDRNKVFVPHPTRTIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHENQGNSLYLLGLNYFNQLINRSMIQPIYNYSGEAYACRVHDMVLDLICNLSNEAKFVNLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPFTDIKSMSRVRSITIFPSAIEVMPSLSRFDVLRVLDLSRCNLGENSSMQLNLKGVGHLTHLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNHNLKELPSTVCNFRRLIYLNLVGCQVVPPVGVLQNLTSIEVLSGILVSLNIIAQELGNLKRLRELNILFNDGSLDLYEGFVKSLCNLHHIESLIIGCNSRETSSFELMDLLGERWVPPVHFREFVSSMPSQLSALRGWIKRDPSHLSNLSELILTSVKEVQQDDVVIIGALSSLRRLCIKSTYQTQRLLVIPADGFRCIVGFHLD

superfamily: SSF52540
150-407 SSF52540

TIAIDPCLRALYAEATELVGIYGKRDQGLMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTED

Gene3D: G3DSA:3.40.50.300
191-291 G3DSA:3.40.50.300

NKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGI

HMMPfam: PF00931
IPR002182
191-463 NB-ARC,NBS
NB-ARC

NKRLKKVSIVGFGGLGKTTLARAVYEKIKGDFDCRAFVPVGQNPDMKKVLRDILIDLGNPHSDLAMLDANQLIKKLHEFLENKRYLVIIDDIWDEKLWEGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSDGDSVYQMEPLSVDDSRMLFYKRIFPDENACINEFEQVSRDILKKCGGVPLAIITIASALAGDQKMKPKCEWDILLRSLGSGLTEDNSLEEMRRILSFSYSNLPSNLKTCLLYLCVYPEDSMISRDKLIWKWVAEGFVHHEN

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

KVSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

FLENKRYLVIIDDIW

FPrintScan: PR00364
IPR000767
367-381 DISEASERSIST
Disease resistance protein

CGGVPLAIITIASAL

superfamily: SSF52047
519-827 SSF52047,LRR

NLLDGTGNSMSSQSNCRRLSLQKRNEDHQARPFTDIKSMSRVRSITIFPSAIEVMPSLSRFDVLRVLDLSRCNLGENSSMQLNLKGVGHLTHLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNHNLKELPSTVCNFRRLIYLNLVGCQVVPPVGVLQNLTSIEVLSGILVSLNIIAQELGNLKRLRELNILFNDGSLDLYEGFVKSLCNLHHIESLIIGCNSRETSSFELMDLLGERWVPPVHFREFVSSMPSQLSALRGWIKRDPSHLSNLSELILTSVKEVQQDDVVIIGALSSLRRLCIKSTYQT

Gene3D: G3DSA:3.80.10.10
550-746 G3DSA:3.80.10.10

PFTDIKSMSRVRSITIFPSAIEVMPSLSRFDVLRVLDLSRCNLGENSSMQLNLKGVGHLTHLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNHNLKELPSTVCNFRRLIYLNLVGCQVVPPVGVLQNLTSIEVLSGILVSLNIIAQELGNLKRLRELNILFNDGSLDLYEGFVKSLCNLHHIESLIIGCNSRETSS

HMMPfam: PF12799
609-643 LRR_4,Leucine Rich repeats (2 copies)

THLRYLGLEGTNISKLPAEIGKLQFLEVLDLENNH

FPrintScan: PR00364
IPR000767
629-645 DISEASERSIST
Disease resistance protein

GKLQFLEVLDLENNHNL

Gene3D: G3DSA:3.80.10.10
778-822 G3DSA:3.80.10.10

RGWIKRDPSHLSNLSELILTSVKEVQQDDVVIIGALSSLRRLCIK


Diseases

Disease Pathogen Avirulence gene
Powdery mildew (barley) Blumeria graminis

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox