PRGDB00061437 (Rp1-D)

From PRG Wiki
Jump to: navigation, search
Rp1-D
Gene Type Reference_R-Genes,_manually_curated
GenBank 5702195 (AF107293)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Zea mays

Comment?

Zea mays rust resistance protein (Rp1-D) gene, complete cds.

DNA Sequence

ATGGCCGACTTGGCGCTCGCCGGCTTAAGGTGGGCAGCATCGCCGATTGTCAACGAGCTTCTTACTAAAGCTTCAGCTTACCTCAGTGTGGACATGGTGCGTGAGATCCAACGACTAGAAGCCACTGTCCTGCCACAGTTCGAGCTGGTGATTCAAGCGGCCCAGAAGAGCCCCCACAGGGGCATACTGGAGGCATGGCTCCGGCGTCTCAAAGAAGCCTACTATGATGCCGAGGACTTGTTGGACGAGCATGAGTACAATGTCCTTGAGGGCAAGGCCAAGAGCGAAAAAAGTCTCCTGCTGGGAGAGCATGGAAGCTCCTCCACTGCAACTACTGTCATGAAGCCTTTTCATGCTGCTATGAGCAGGGCACGGAACTTGCTCCCTCAAAACAGAAGGCTAATTAGCAAGATGAACGAGCTCAAAGCAATCCTGACAGAAGCCCAACAACTTCGAGATCTTCTTGGTTTGCCACATGGCAATACCGTCGAGTGGCCAGCTGCAGCACCTACCAGTGTTCCCACAACCACATCACTTCCCACTTCCAAGGTTTTTGGTCGCGACAGGGATCGTGATCGTATAGTAGATTTTCTTCTCGGCAAGACAACAACTGCTGAGGCAAGCTCAGCTAAGTACTCGGGTTTGGCCATTGTTGGATTGGGAGGAATGGGGAAGTCCACCTTAGCACAGTATGTCTATAATGACAAAAGGATAGAAGAATGCTTTGATATCAGGATGTGGGTGTGCATCTCACGCAAACTTGATGTGCATCGTCACACAAGGGAGATTATAGAGTCTGCAAAAAAGGGAGAGTGCCCACGTGTTGATAATCTCGATACTCTCCAGTGCAAATTACGTGATATACTACAAGAGTCACAGAAATTCCTGCTTGTCTTGGATGATGTTTGGTTTGAAAAATCTCATAATGAGACAGAGTGGGAGTTATTCCTTGCTCCATTAGTCTCTAAACAGTCAGGGAGCAAAGTTTTGGTGACTTCTCGAAGTAAAACACTTCCTGCCGCTATTTGTTGTGAACAAGAACATGTCATTCATTTGAAAAACATGGATGATACTGAGTTTTTGGCTCTTTTTAAACACCATGCTTTCTCTGGAGCAGAAATCAAAGACCAAGTATTACGCACGAAGCTGGAAGACACTGCAGTGGAGATTGCTAAAAGGCTTGGACAATGTCCTTTGGCAGCAAAAGTTCTGGGTTCTCGATTGTGCAGGAAAAAGGATATTGCTGAATGGAAAGCTGCTCTAAAGATTGGAGATTTAAGTGATCCCTTCACATCTCTGTTGTGGAGTTACGAGAAGTTAGATCCACGTCTGCAGAGGTGCTTCTTGTATTGCAGCTTGTTTCCAAAAGGTCATAGATATGAATCTAATGAGTTGGTTCACCTTTGGGTGGCAGAAGGATTTGTTGGTTCATGCAATTTGAGTAGGAGAACGTTAGAAGAGGTTGGGATGGATTACTTCAATGATATGGTCTCTGTATCTTTCTTCCAATTGGTTTTTCATATCTATTGTGATTCGTACTATGTCATGCATGATATCCTTCATGATTTTGCAGAGTCACTCTCTAGAGAAGACTGCTTTAGATTAGAAGATGATAATGTGACAGAAATACCATGCACTGTTCGACATCTATCTATTCATGTTCATAGTATGCAAAAGCATAAGCAAATTATCTGCAAGCTACATCATTTACGCACTATTATCTGCATCGATCCGCTAATGGATGGCCCAAGTGATATTTTTGATGGCATGCTACGGAACCAAAGAAAACTGCGTGTATTGTCTCTGTCATTTTACAACAGCAAAAATTTGCCAGAATCTATTGGTGAGCTGAAGCACCTCCGGTATTTGAACCTCATCAGGACGTTAGTTTCTGAATTGCCTAGATCATTATGTACTCTCTACCACTTACAATTACTTTGGTTAAACCACATGGTGGAGAATTTGCCTGACAAACTATGCAATTTAAGAAAGCTACGACATCTAGGAGCGTACGTGAATGATTTCGCGATTGAAAAGCCTATTTGCCAAATTCTGAATATAGGTAAGTTAACGTCGCTACAACACATTTATGTCTTTTCTGTACAAAAGAAGCAAGGCTATGAGTTGCGACAGTTGAAGGACTTGAATGAGCTTGGTGGCAGTTTAAAAGTGAAAAATCTTGAGAATGTCATTGGAAAGGATGAAGCCGTAGAGTCGAAGCTATATCTGAAAAGTCGCCTTAAAGAGTTGGCACTTGAGTGGAGTTCCGAGAATGGAATGGATGCAATGGATATTCTAGAAGGTCTGAGACCACCACCCCAACTGAGTAAGCTCACAATCGAAGGTTACAGATCTGATACATATCCTGGGTGGTTACTAGAGCGATCCTATTTTGAGAATTTGGAAAGTTTTCAGCTTAGTAATTGCAGTTTGCTAGAAGGCCTACCACCAGATACAGAGCTCCTTCGGAATTGCTCTAGGTTGCGTATAAACTTTGTTCCAAATTTGAAGGAACTATCTAATCTTCCAGCAGGCCTTACAGATTTATCAATTGGTTGGTGCCCACTGCTTATGTTTATCACCAACAATGAGCTAGGACAGCATGACTTGAGGGAAAATATAATAATGAAGGCAGCCGACCTGGCATCTAAACTTGCATTGATGTGGGAGGTGGATTCAGGAAAAGAAGTTAGGAGAGTACTGTTTGAAGACTATGTATCTCTGATTCGGTTGATGACATTGATGATGGATGATGATATATCAAAGCATCTTCAAATTATTGGAAGTGTTCTGGTTCCGGAGGAAAGAGAAGATAAAGAAAACATCATCAAGGCATGGCTCTTTTGCCATGAGCAGAGGATAAGATTCATTTATGGAAGGGCCATGGAGATGCCATTGGTTCTACCGTCAGGACTCTGTGAACTTTCTCTTTCTTCATGCAGTATTACAGATGAAGCTTTAGCTATTTGCCTTGGTGGCCTCACTTCACTGAGAACTTTACAATTGAAATATAATATGGCATTAACTACACTTCCATCAGAAAAGGTGTTTGAGCATTTGACAAAGCTTGATAGGTTGGTTGTAAGTGGTTGTTTGTGTCTCAAATCACTGGGGGGCTTACGTGCTGCTCCATCTCTTTCCTGTTTTAACTGTTGGGATTGTCCTTCTTTAGAGCTAGCACGGGGAGCAGAACTAATGCCGTTGAACCTTGCTAGCAATCTCAGCATCCTTGGCTGCATTCTTGCAGCTGATTCGTTCATTAATGGCTTGCCACATCTGAAACATCTTTCCATTGATGTCTGCAGATGCTCCCCATCCTTATCGATTGGCCACCTGACCTCCCTTGAATCATTATGTCTAAATGGTCTCCCTGATCTTTGCTTTGTTGAAGGCTTGTCTTCCCTGCACCTTAAGCGCCTAAGTTTAGTAGATGTTGCAAACCTCACTGCCAAGTGCATCTCACCGTTTCGTGTCCAGGAATCGCTCACGGTTAGTAGCTCTGTATTGCTCAACCACATGCTAATGGCTGAAGGGTTTACAGCCCCACCAAATCTTACTCTTTTAGATTGCAAGGAGCCGTCAGTTTCATTTGAAGAACCTGCAAATCTCTCATCCGTCAAGCACCTGCACTTTTCATGTTGCGAAACAGAGTCCCTGCCTAGAAATCTAAAATCTGTCTCAAGTCTGGAGAGTCTTTCTATAGAACGATGCCCCAACATAGCATCTTTACCAGATCTGCCGTCCTCCCTCCAGCGCATAACTATATTGAATTGCCCCGTCTTGATGAAGAATTGCCAAGAACCTGATGGAGAAAGCTGGCCAAAGATTTCGCACGTTCGTTGGAAGAGCTTTCCACCAAAATCGATCTGGCTTCCTTAG


Protein sequences

Name Description Sequence
rust resistance protein rust resistance protein [Zea mays].

MADLALAGLRWAASPIVNELLTKASAYLSVDMVREIQRLEATVLPQFELVIQAAQKSPHRGILEAWLRRLKEAYYDAEDLLDEHEYNVLEGKAKSEKSLLLGEHGSSSTATTVMKPFHAAMSRARNLLPQNRRLISKMNELKAILTEAQQLRDLLGLPHGNTVEWPAAAPTSVPTTTSLPTSKVFGRDRDRDRIVDFLLGKTTTAEASSAKYSGLAIVGLGGMGKSTLAQYVYNDKRIEECFDIRMWVCISRKLDVHRHTREIIESAKKGECPRVDNLDTLQCKLRDILQESQKFLLVLDDVWFEKSHNETEWELFLAPLVSKQSGSKVLVTSRSKTLPAAICCEQEHVIHLKNMDDTEFLALFKHHAFSGAEIKDQVLRTKLEDTAVEIAKRLGQCPLAAKVLGSRLCRKKDIAEWKAALKIGDLSDPFTSLLWSYEKLDPRLQRCFLYCSLFPKGHRYESNELVHLWVAEGFVGSCNLSRRTLEEVGMDYFNDMVSVSFFQLVFHIYCDSYYVMHDILHDFAESLSREDCFRLEDDNVTEIPCTVRHLSIHVHSMQKHKQIICKLHHLRTIICIDPLMDGPSDIFDGMLRNQRKLRVLSLSFYNSKNLPESIGELKHLRYLNLIRTLVSELPRSLCTLYHLQLLWLNHMVENLPDKLCNLRKLRHLGAYVNDFAIEKPICQILNIGKLTSLQHIYVFSVQKKQGYELRQLKDLNELGGSLKVKNLENVIGKDEAVESKLYLKSRLKELALEWSSENGMDAMDILEGLRPPPQLSKLTIEGYRSDTYPGWLLERSYFENLESFQLSNCSLLEGLPPDTELLRNCSRLRINFVPNLKELSNLPAGLTDLSIGWCPLLMFITNNELGQHDLRENIIMKAADLASKLALMWEVDSGKEVRRVLFEDYVSLIRLMTLMMDDDISKHLQIIGSVLVPEEREDKENIIKAWLFCHEQRIRFIYGRAMEMPLVLPSGLCELSLSSCSITDEALAICLGGLTSLRTLQLKYNMALTTLPSEKVFEHLTKLDRLVVSGCLCLKSLGGLRAAPSLSCFNCWDCPSLELARGAELMPLNLASNLSILGCILAADSFINGLPHLKHLSIDVCRCSPSLSIGHLTSLESLCLNGLPDLCFVEGLSSLHLKRLSLVDVANLTAKCISPFRVQESLTVSSSVLLNHMLMAEGFTAPPNLTLLDCKEPSVSFEEPANLSSVKHLHFSCCETESLPRNLKSVSSLESLSIERCPNIASLPDLPSSLQRITILNCPVLMKNCQEPDGESWPKISHVRWKSFPPKSIWLP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF129
5-1258 PTHR23155:SF129,PUTATIVE RUST RESISTANCE PROTEIN (OS01G0781200 PROTEIN)

ALAGLRWAASPIVNELLTKASAYLSVDMVREIQRLEATVLPQFELVIQAAQKSPHRGILEAWLRRLKEAYYDAEDLLDEHEYNVLEGKAKSEKSLLLGEHGSSSTATTVMKPFHAAMSRARNLLPQNRRLISKMNELKAILTEAQQLRDLLGLPHGNTVEWPAAAPTSVPTTTSLPTSKVFGRDRDRDRIVDFLLGKTTTAEASSAKYSGLAIVGLGGMGKSTLAQYVYNDKRIEECFDIRMWVCISRKLDVHRHTREIIESAKKGECPRVDNLDTLQCKLRDILQESQKFLLVLDDVWFEKSHNETEWELFLAPLVSKQSGSKVLVTSRSKTLPAAICCEQEHVIHLKNMDDTEFLALFKHHAFSGAEIKDQVLRTKLEDTAVEIAKRLGQCPLAAKVLGSRLCRKKDIAEWKAALKIGDLSDPFTSLLWSYEKLDPRLQRCFLYCSLFPKGHRYESNELVHLWVAEGFVGSCNLSRRTLEEVGMDYFNDMVSVSFFQLVFHIYCDSYYVMHDILHDFAESLSREDCFRLEDDNVTEIPCTVRHLSIHVHSMQKHKQIICKLHHLRTIICIDPLMDGPSDIFDGMLRNQRKLRVLSLSFYNSKNLPESIGELKHLRYLNLIRTLVSELPRSLCTLYHLQLLWLNHMVENLPDKLCNLRKLRHLGAYVNDFAIEKPICQILNIGKLTSLQHIYVFSVQKKQGYELRQLKDLNELGGSLKVKNLENVIGKDEAVESKLYLKSRLKELALEWSSENGMDAMDILEGLRPPPQLSKLTIEGYRSDTYPGWLLERSYFENLESFQLSNCSLLEGLPPDTELLRNCSRLRINFVPNLKELSNLPAGLTDLSIGWCPLLMFITNNELGQHDLRENIIMKAADLASKLALMWEVDSGKEVRRVLFEDYVSLIRLMTLMMDDDISKHLQIIGSVLVPEEREDKENIIKAWLFCHEQRIRFIYGRAMEMPLVLPSGLCELSLSSCSITDEALAICLGGLTSLRTLQLKYNMALTTLPSEKVFEHLTKLDRLVVSGCLCLKSLGGLRAAPSLSCFNCWDCPSLELARGAELMPLNLASNLSILGCILAADSFINGLPHLKHLSIDVCRCSPSLSIGHLTSLESLCLNGLPDLCFVEGLSSLHLKRLSLVDVANLTAKCISPFRVQESLTVSSSVLLNHMLMAEGFTAPPNLTLLDCKEPSVSFEEPANLSSVKHLHFSCCETESLPRNLKSVSSLESLSIERCPNIASLPDLPSSLQRITILNC

HMMPanther: PTHR23155
5-1258 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ALAGLRWAASPIVNELLTKASAYLSVDMVREIQRLEATVLPQFELVIQAAQKSPHRGILEAWLRRLKEAYYDAEDLLDEHEYNVLEGKAKSEKSLLLGEHGSSSTATTVMKPFHAAMSRARNLLPQNRRLISKMNELKAILTEAQQLRDLLGLPHGNTVEWPAAAPTSVPTTTSLPTSKVFGRDRDRDRIVDFLLGKTTTAEASSAKYSGLAIVGLGGMGKSTLAQYVYNDKRIEECFDIRMWVCISRKLDVHRHTREIIESAKKGECPRVDNLDTLQCKLRDILQESQKFLLVLDDVWFEKSHNETEWELFLAPLVSKQSGSKVLVTSRSKTLPAAICCEQEHVIHLKNMDDTEFLALFKHHAFSGAEIKDQVLRTKLEDTAVEIAKRLGQCPLAAKVLGSRLCRKKDIAEWKAALKIGDLSDPFTSLLWSYEKLDPRLQRCFLYCSLFPKGHRYESNELVHLWVAEGFVGSCNLSRRTLEEVGMDYFNDMVSVSFFQLVFHIYCDSYYVMHDILHDFAESLSREDCFRLEDDNVTEIPCTVRHLSIHVHSMQKHKQIICKLHHLRTIICIDPLMDGPSDIFDGMLRNQRKLRVLSLSFYNSKNLPESIGELKHLRYLNLIRTLVSELPRSLCTLYHLQLLWLNHMVENLPDKLCNLRKLRHLGAYVNDFAIEKPICQILNIGKLTSLQHIYVFSVQKKQGYELRQLKDLNELGGSLKVKNLENVIGKDEAVESKLYLKSRLKELALEWSSENGMDAMDILEGLRPPPQLSKLTIEGYRSDTYPGWLLERSYFENLESFQLSNCSLLEGLPPDTELLRNCSRLRINFVPNLKELSNLPAGLTDLSIGWCPLLMFITNNELGQHDLRENIIMKAADLASKLALMWEVDSGKEVRRVLFEDYVSLIRLMTLMMDDDISKHLQIIGSVLVPEEREDKENIIKAWLFCHEQRIRFIYGRAMEMPLVLPSGLCELSLSSCSITDEALAICLGGLTSLRTLQLKYNMALTTLPSEKVFEHLTKLDRLVVSGCLCLKSLGGLRAAPSLSCFNCWDCPSLELARGAELMPLNLASNLSILGCILAADSFINGLPHLKHLSIDVCRCSPSLSIGHLTSLESLCLNGLPDLCFVEGLSSLHLKRLSLVDVANLTAKCISPFRVQESLTVSSSVLLNHMLMAEGFTAPPNLTLLDCKEPSVSFEEPANLSSVKHLHFSCCETESLPRNLKSVSSLESLSIERCPNIASLPDLPSSLQRITILNC

superfamily: SSF52540
166-422 SSF52540

PAAAPTSVPTTTSLPTSKVFGRDRDRDRIVDFLLGKTTTAEASSAKYSGLAIVGLGGMGKSTLAQYVYNDKRIEECFDIRMWVCISRKLDVHRHTREIIESAKKGECPRVDNLDTLQCKLRDILQESQKFLLVLDDVWFEKSHNETEWELFLAPLVSKQSGSKVLVTSRSKTLPAAICCEQEHVIHLKNMDDTEFLALFKHHAFSGAEIKDQVLRTKLEDTAVEIAKRLGQCPLAAKVLGSRLCRKKDIAEWKAALK

Gene3D: G3DSA:3.40.50.300
182-333 G3DSA:3.40.50.300

SKVFGRDRDRDRIVDFLLGKTTTAEASSAKYSGLAIVGLGGMGKSTLAQYVYNDKRIEECFDIRMWVCISRKLDVHRHTREIIESAKKGECPRVDNLDTLQCKLRDILQESQKFLLVLDDVWFEKSHNETEWELFLAPLVSKQSGSKVLVTS

HMMPfam: PF00931
IPR002182
214-477 NB-ARC,NBS
NB-ARC

GLAIVGLGGMGKSTLAQYVYNDKRIEECFDIRMWVCISRKLDVHRHTREIIESAKKGECPRVDNLDTLQCKLRDILQESQKFLLVLDDVWFEKSHNETEWELFLAPLVSKQSGSKVLVTSRSKTLPAAICCEQEHVIHLKNMDDTEFLALFKHHAFSGAEIKDQVLRTKLEDTAVEIAKRLGQCPLAAKVLGSRLCRKKDIAEWKAALKIGDLSDPFTSLLWSYEKLDPRLQRCFLYCSLFPKGHRYESNELVHLWVAEGFVGS

FPrintScan: PR00364
IPR000767
214-229 DISEASERSIST
Disease resistance protein

GLAIVGLGGMGKSTLA

FPrintScan: PR00364
IPR000767
289-303 DISEASERSIST
Disease resistance protein

LQESQKFLLVLDDVW

FPrintScan: PR00364
IPR000767
394-408 DISEASERSIST
Disease resistance protein

LGQCPLAAKVLGSRL

superfamily: SSF52058
515-1102 SSF52058,LRR

VMHDILHDFAESLSREDCFRLEDDNVTEIPCTVRHLSIHVHSMQKHKQIICKLHHLRTIICIDPLMDGPSDIFDGMLRNQRKLRVLSLSFYNSKNLPESIGELKHLRYLNLIRTLVSELPRSLCTLYHLQLLWLNHMVENLPDKLCNLRKLRHLGAYVNDFAIEKPICQILNIGKLTSLQHIYVFSVQKKQGYELRQLKDLNELGGSLKVKNLENVIGKDEAVESKLYLKSRLKELALEWSSENGMDAMDILEGLRPPPQLSKLTIEGYRSDTYPGWLLERSYFENLESFQLSNCSLLEGLPPDTELLRNCSRLRINFVPNLKELSNLPAGLTDLSIGWCPLLMFITNNELGQHDLRENIIMKAADLASKLALMWEVDSGKEVRRVLFEDYVSLIRLMTLMMDDDISKHLQIIGSVLVPEEREDKENIIKAWLFCHEQRIRFIYGRAMEMPLVLPSGLCELSLSSCSITDEALAICLGGLTSLRTLQLKYNMALTTLPSEKVFEHLTKLDRLVVSGCLCLKSLGGLRAAPSLSCFNCWDCPSLELARGAELMPLNLASNLSILGCILAADSFINGLPHLKHLSIDVCR

Gene3D: G3DSA:3.80.10.10
591-704 G3DSA:3.80.10.10

LRNQRKLRVLSLSFYNSKNLPESIGELKHLRYLNLIRTLVSELPRSLCTLYHLQLLWLNHMVENLPDKLCNLRKLRHLGAYVNDFAIEKPICQILNIGKLTSLQHIYVFSVQKK

Gene3D: G3DSA:3.80.10.10
763-852 G3DSA:3.80.10.10

MDILEGLRPPPQLSKLTIEGYRSDTYPGWLLERSYFENLESFQLSNCSLLEGLPPDTELLRNCSRLRINFVPNLKELSNLPAGLTDLSIG

FPrintScan: PR00364
IPR000767
796-812 DISEASERSIST
Disease resistance protein

SYFENLESFQLSNCSLL

Gene3D: G3DSA:3.80.10.10
974-1138 G3DSA:3.80.10.10

ELSLSSCSITDEALAICLGGLTSLRTLQLKYNMALTTLPSEKVFEHLTKLDRLVVSGCLCLKSLGGLRAAPSLSCFNCWDCPSLELARGAELMPLNLASNLSILGCILAADSFINGLPHLKHLSIDVCRCSPSLSIGHLTSLESLCLNGLPDLCFVEGLSSLHLK

superfamily: SSF52058
1085-1282 SSF52058,LRR

SFINGLPHLKHLSIDVCRCSPSLSIGHLTSLESLCLNGLPDLCFVEGLSSLHLKRLSLVDVANLTAKCISPFRVQESLTVSSSVLLNHMLMAEGFTAPPNLTLLDCKEPSVSFEEPANLSSVKHLHFSCCETESLPRNLKSVSSLESLSIERCPNIASLPDLPSSLQRITILNCPVLMKNCQEPDGESWPKISHVRWK

Gene3D: G3DSA:3.80.10.10
1161-1258 G3DSA:3.80.10.10

SLTVSSSVLLNHMLMAEGFTAPPNLTLLDCKEPSVSFEEPANLSSVKHLHFSCCETESLPRNLKSVSSLESLSIERCPNIASLPDLPSSLQRITILNC


Diseases

Disease Pathogen Avirulence gene
Maize rust Puccinia sorghi

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox