PRGDB00061438 (Pm3)

From PRG Wiki
Jump to: navigation, search
Pm3
Gene Type Reference_R-Genes,_manually_curated
GenBank 37624723 (AY325736)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum powdery mildew resistance protein PM3b (Pm3) gene, Pm3-b allele, complete cds.

DNA Sequence

ATGGCAGAGCGGGTGGTCACCATGGCGATCGGGCCACTGGTGTCCATGCTGAAGGACAAGGCGTCCAGCTACCTCCTGGACCAGTACAAGGTCATGGAGGGAATGGAGGAGCAGCACAAGATTCTCAAACGCAAGCTTCCGGCCATCCTCGACGTCATCACCGATGTCGAGGAGCAGGCCATGGCACAGAGAGAAGGTGCCAAAGCCTGGCTTCAGGAGCTCAGGACAGTCGCCTATGTGGCAAATGAAGTCTTCGACGAATTCAAGTACGAAGCCCTACGCCGTGAAGCCAAGAAGAATGGGCACTACATAAAGCTCGGCTTCGATGTAATTAAACTCTTCCCTACTCACAACCGTGTTGCGTTCCGTTACAAAATGGGTCGCAAGCTTTGCCTGATTCTGCAAGCCGTTGAGGTCCTCATAGCAGAGATGCAGGTCTTTGGGTTCAAGTACCAACCACAGCCACCGGTGTCCAAAGAGTGGAGGCATACAGATTATGTTAGCATTGACCCACAAGAAATTGCCAGCAGATCCAGACACGAAGATAAGAAGAACATTATTGGTATACTAGTTGATGAAGCTAGCAATGCAGATCTCACAGTTGTTCCTGTGGTTGCAATGGGGGGCCTTGGCAAGACCACATTAGCGCAACTCATATACAATGATCCTGAAATTCAGAAGCATTTCCAGTTGCTGCTCTGGGTTTGTGTCTCTGATACCTTTGATGTGAACTCCCTGGCCAAGAGTATAGTTGAAGCATCCCCCAATAAGAATGTTGATACAGACAAACCACCATTGGCTAGACTTCAAAAACTGGTCAGCGGACAGCGGTATCTCCTTGTATTGGATGATGTTTGGGACAACAAAGAGTTACGTAAGTGGGAAAGGCTGAAGGTATGTCTTCAGCATGGTGGCATGGGCAGTGCAGTGTTGACAACAACTCGTGATAAACGAGTTGCTGAAATTATGGGTGCAGATAGGGCAGCCTACAATCTCAATGCTTTGGAGGATCACTTCATAAAGGAAATTATTGTGGATAGAGCATTCAGTTCAGAGAATGGAAAGATTCCCGAGCTACTCGAGATGGTTGGTGAGATTGTGAAGAGATGTTGTGGCTCTCCATTAGCTGCAAGTGCACTGGGCTCTGTACTTCGTACCAAGACCACCGTGAAAGAATGGAATGCTATAGCATCTAGAAGCAGCATTTGCACTGAGGAAACTGGAATCTTGCCAATACTCAAGCTTAGCTACAACGACTTGCCATCGCACATGAAGCAGTGCTTTGCTTTTTGTGCTGTATTTCCAAAGGATTACAAGATTGATGTAGCGAAGTTGATCCAACTATGGATCGCAAATGGCTTTATCCCTGAACACAAGGAAGATAGTCTTGAAACCATTGGACAACTTATTTTTGATGAGCTTGCTTCAAGGTCATTCTTTCTGGATATAGAGAAGAGTAAAGAAGACTGGGAGTATTATTCCAGAACAACATGTAAAATCCACGATCTTATGCATGATATTGCAATGTCTGTTATGGAAAAGGAATGTGTTGTTGCAACTATGGAACCAAGTGAAATTGAGTGGCTTCCAGATACTGCTCGGCATTTGTTCTTGTCATGTGAAGAAACGGAACGTATTTTGAATGATTCTATGGAGGAAAGATCCCCTGCTATTCAAACATTGCTATGTGATAGTAATGTGTTCAGCCCATTGAAGCATCTATCAAAATATAGCTCTTTGCACGCCTTGAAGCTCTGTATTAGAGGCACAGAATCATTTCTACTCAAACCAAAGTATCTGCATCACCTGAGGTACCTTGATCTCTCAGAAAGTTCTATCAAAGCACTTCCTGAGGATATAAGTATTCTATATAACCTGCAAGTGTTGGACCTTTCCTACTGTAATTATCTTGATCGACTTCCAAGGCAAATGAAGTATATGACTTCCCTCTGCCACCTCTACACTCATGGATGTCGGAACTTGAAGAGCATGCCTCCAGGACTTGAAAATCTCACTAAGCTGCAGACACTCACAGTTTTTGTAGCAGGAGTTCCTGGCCCTGATTGCGCTGATGTTGGAGAGCTGCATGGTCTAAACATTGGTGGTCGGCTAGAGCTATGCCAGGTAGAGAATGTTGAAAAAGCAGAAGCAGAAGTGGCAAACCTTGGTGGTCAGCTAGAGCTGCAGCATTTAAACCTTGGTGATCAGCTAGAGCTACGCCGGGTAGAGAATGTTAAAAAAGCAGAGGCAAAAGTGGCGAATCTTGGAAACAAGAAGGATCTCCGTGAACTGACATTAAGATGGACTGAGGTTGGCGACAGCAAGGTGCTCGACAAGTTCGAACCTCATGGTGGGCTGCAGGTTCTGAAGATATATAAATATGGAGGGAAGTGTATGGGTATGTTGCAAAACATGGTTGAGATCCATCTTTCTGGTTGTGAAAGATTGCAGGTTTTGTTCAGTTGTGGTACATCCTTCACGTTTCCAAAACTGAAGGTGCTTACACTAGAGCATTTATTGGATTTTGAGAGATGGTGGGAAATAAATGAGGCACAAGAAGAACAGATAATATTTCCTCTGCTTGAGAAGTTGTTTATTCGGCATTGTGGAAAGCTGATAGCATTACCTGAAGCACCATTGCTTGGAGAACCAAGTCGTGGAGGTAATAGACTGGTATGCACACCATTTTCTCTGCTTGAGAACTTGTTTATTTGGTATTGTGGAAAGCTGGTACCATTGCGTGAAGCACCACTGGTTCATGAAAGTTGTAGTGGAGGTTATAGGTTGGTACAGTCAGCATTTCCTGCTCTAAAGGTACTTGCATTGGAAGACTTGGGGAGTTTTCAGAAATGGGATGCTGCTGTCGAAGGAGAACCGATATTGTTTCCTCAGCTTGAGACACTATCAGTTCAGAAATGCCCAAAGCTAGTAGATTTACCCGAAGCACCAAAACTCAGTGTACTAGTAATTGAAGATGGCAAGCAAGAGGTGTTCCATTTTGTAGACAGGTATTTATCTTCATTGACCAATCTGACACTGAGGCTAGAACACAGAGAAACAACATCAGAGGCTGAATGCACTTCAATTGTACCTGTGGACAGCAAAGAGAAATGGAACCAGAAATCCCCTCTTACAGTTCTGGAGTTAGGATGCTGCAACTCATTCTTTGGACCAGGTGCACTAGAGCCGTGGGACTATTTTGTACACCTTGAAAAGTTGGAAATTGATAGATGTGATGTGCTCGTCCACTGGCCAGAGAATGTGTTCCAAAGCTTGGTATCCTTGAGGACATTACTGATTAGAAACTGCAAAAATCTGACTGGATATGCACAAGCTCCTCTTGAGCCGTTGGCGTCTGAAAGGAGTCAGCACCCGAGAGGTCTGGAGTCTCTTTGCTTAAGAAACTGCCCAAGTTTAGTAGAGATGTTCAACGTCCCGGCATCTCTCAAGAAAATGACTATTGGTGGGTGCATTAAGCTTGAGTCCATATTCGGCAAGCAACAGGGCATGGCAGAGTTAGTCCAAGTATCTTCTAGCAGTGAGGCAATCATGCCTGCAACTGTATCAGAGTTGCCATCCACACCCATGAATCACTTTTGTCCATGCCTAGAAGATCTATGCTTATCAGCATGTGGAAGCTTACCAGCGGTTCTAAATCTGCCTCCATCCTTAAAGACCTTAGAAATGGATCGTTGTAGTAGTATTCAAGTCCTATCATGCCAGCTGGGTGGGCTCCAGAAACCAGAAGCCACTACCTCCAGAAGCAGAAGTCCTATCATGCCACAGCCACTAGCAGCAGCAACAGCACCAGCTGCAAGAGAGCATTTACTTCCTCCCCATCTCGAATATCTAACAATACTGAACTGTGCTGGCATGTTGGGTGGGACTCTCCGTCTGCCTGCACCCCTCAAGAGACTGTTCATTATTGGCAACAGTGGGCTGACATCGCTGGAGTGTCTGTCGGGAGAGCACCCCCCATCGCTGGAATCCCTTTGGCTTGAAAGATGCAGTACCCTGGCATCCCTGCCGAATGAGCCGCAAGTATACAGGTCTCTCTGGTCTCTTGAAATTACAGGCTGCCCTGCTATAAAGAAGCTCCCTAGATGCCTGCAGCAGCAACTGGGCAGCATCAAACGCAAATGGCTAGATGCCCGTTATGAAGTAACGGAATTCAAACCATTGAAACCGAAGACATGGAAGGAAATACCGAGGCTAGTCCGTGAGCGGAGGCAGGCCTGCCGGAGCTGA


Protein sequences

Name Description Sequence
powdery mildew resistance protein PM3b powdery mildew resistance protein PM3b [Triticum aestivum].

MAERVVTMAIGPLVSMLKDKASSYLLDQYKVMEGMEEQHKILKRKLPAILDVITDVEEQAMAQREGAKAWLQELRTVAYVANEVFDEFKYEALRREAKKNGHYIKLGFDVIKLFPTHNRVAFRYKMGRKLCLILQAVEVLIAEMQVFGFKYQPQPPVSKEWRHTDYVSIDPQEIASRSRHEDKKNIIGILVDEASNADLTVVPVVAMGGLGKTTLAQLIYNDPEIQKHFQLLLWVCVSDTFDVNSLAKSIVEASPNKNVDTDKPPLARLQKLVSGQRYLLVLDDVWDNKELRKWERLKVCLQHGGMGSAVLTTTRDKRVAEIMGADRAAYNLNALEDHFIKEIIVDRAFSSENGKIPELLEMVGEIVKRCCGSPLAASALGSVLRTKTTVKEWNAIASRSSICTEETGILPILKLSYNDLPSHMKQCFAFCAVFPKDYKIDVAKLIQLWIANGFIPEHKEDSLETIGQLIFDELASRSFFLDIEKSKEDWEYYSRTTCKIHDLMHDIAMSVMEKECVVATMEPSEIEWLPDTARHLFLSCEETERILNDSMEERSPAIQTLLCDSNVFSPLKHLSKYSSLHALKLCIRGTESFLLKPKYLHHLRYLDLSESSIKALPEDISILYNLQVLDLSYCNYLDRLPRQMKYMTSLCHLYTHGCRNLKSMPPGLENLTKLQTLTVFVAGVPGPDCADVGELHGLNIGGRLELCQVENVEKAEAEVANLGGQLELQHLNLGDQLELRRVENVKKAEAKVANLGNKKDLRELTLRWTEVGDSKVLDKFEPHGGLQVLKIYKYGGKCMGMLQNMVEIHLSGCERLQVLFSCGTSFTFPKLKVLTLEHLLDFERWWEINEAQEEQIIFPLLEKLFIRHCGKLIALPEAPLLGEPSRGGNRLVCTPFSLLENLFIWYCGKLVPLREAPLVHESCSGGYRLVQSAFPALKVLALEDLGSFQKWDAAVEGEPILFPQLETLSVQKCPKLVDLPEAPKLSVLVIEDGKQEVFHFVDRYLSSLTNLTLRLEHRETTSEAECTSIVPVDSKEKWNQKSPLTVLELGCCNSFFGPGALEPWDYFVHLEKLEIDRCDVLVHWPENVFQSLVSLRTLLIRNCKNLTGYAQAPLEPLASERSQHPRGLESLCLRNCPSLVEMFNVPASLKKMTIGGCIKLESIFGKQQGMAELVQVSSSSEAIMPATVSELPSTPMNHFCPCLEDLCLSACGSLPAVLNLPPSLKTLEMDRCSSIQVLSCQLGGLQKPEATTSRSRSPIMPQPLAAATAPAAREHLLPPHLEYLTILNCAGMLGGTLRLPAPLKRLFIIGNSGLTSLECLSGEHPPSLESLWLERCSTLASLPNEPQVYRSLWSLEITGCPAIKKLPRCLQQQLGSIKRKWLDARYEVTEFKPLKPKTWKEIPRLVRERRQACRS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
6-1404 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTMAIGPLVSMLKDKASSYLLDQYKVMEGMEEQHKILKRKLPAILDVITDVEEQAMAQREGAKAWLQELRTVAYVANEVFDEFKYEALRREAKKNGHYIKLGFDVIKLFPTHNRVAFRYKMGRKLCLILQAVEVLIAEMQVFGFKYQPQPPVSKEWRHTDYVSIDPQEIASRSRHEDKKNIIGILVDEASNADLTVVPVVAMGGLGKTTLAQLIYNDPEIQKHFQLLLWVCVSDTFDVNSLAKSIVEASPNKNVDTDKPPLARLQKLVSGQRYLLVLDDVWDNKELRKWERLKVCLQHGGMGSAVLTTTRDKRVAEIMGADRAAYNLNALEDHFIKEIIVDRAFSSENGKIPELLEMVGEIVKRCCGSPLAASALGSVLRTKTTVKEWNAIASRSSICTEETGILPILKLSYNDLPSHMKQCFAFCAVFPKDYKIDVAKLIQLWIANGFIPEHKEDSLETIGQLIFDELASRSFFLDIEKSKEDWEYYSRTTCKIHDLMHDIAMSVMEKECVVATMEPSEIEWLPDTARHLFLSCEETERILNDSMEERSPAIQTLLCDSNVFSPLKHLSKYSSLHALKLCIRGTESFLLKPKYLHHLRYLDLSESSIKALPEDISILYNLQVLDLSYCNYLDRLPRQMKYMTSLCHLYTHGCRNLKSMPPGLENLTKLQTLTVFVAGVPGPDCADVGELHGLNIGGRLELCQVENVEKAEAEVANLGGQLELQHLNLGDQLELRRVENVKKAEAKVANLGNKKDLRELTLRWTEVGDSKVLDKFEPHGGLQVLKIYKYGGKCMGMLQNMVEIHLSGCERLQVLFSCGTSFTFPKLKVLTLEHLLDFERWWEINEAQEEQIIFPLLEKLFIRHCGKLIALPEAPLLGEPSRGGNRLVCTPFSLLENLFIWYCGKLVPLREAPLVHESCSGGYRLVQSAFPALKVLALEDLGSFQKWDAAVEGEPILFPQLETLSVQKCPKLVDLPEAPKLSVLVIEDGKQEVFHFVDRYLSSLTNLTLRLEHRETTSEAECTSIVPVDSKEKWNQKSPLTVLELGCCNSFFGPGALEPWDYFVHLEKLEIDRCDVLVHWPENVFQSLVSLRTLLIRNCKNLTGYAQAPLEPLASERSQHPRGLESLCLRNCPSLVEMFNVPASLKKMTIGGCIKLESIFGKQQGMAELVQVSSSSEAIMPATVSELPSTPMNHFCPCLEDLCLSACGSLPAVLNLPPSLKTLEMDRCSSIQVLSCQLGGLQKPEATTSRSRSPIMPQPLAAATAPAAREHLLPPHLEYLTILNCAGMLGGTLRLPAPLKRLFIIGNSGLTSLECLSGEHPPSLESLWLERCSTLASLPNEPQVYRSLWSLEITGCPAIKKLPRCLQQQLGSIKRKWLDARYEVTEFKPLKPKTWKEIPR

HMMPanther: PTHR23155:SF138
6-1404 PTHR23155:SF138,OS03G0848700 PROTEIN

VTMAIGPLVSMLKDKASSYLLDQYKVMEGMEEQHKILKRKLPAILDVITDVEEQAMAQREGAKAWLQELRTVAYVANEVFDEFKYEALRREAKKNGHYIKLGFDVIKLFPTHNRVAFRYKMGRKLCLILQAVEVLIAEMQVFGFKYQPQPPVSKEWRHTDYVSIDPQEIASRSRHEDKKNIIGILVDEASNADLTVVPVVAMGGLGKTTLAQLIYNDPEIQKHFQLLLWVCVSDTFDVNSLAKSIVEASPNKNVDTDKPPLARLQKLVSGQRYLLVLDDVWDNKELRKWERLKVCLQHGGMGSAVLTTTRDKRVAEIMGADRAAYNLNALEDHFIKEIIVDRAFSSENGKIPELLEMVGEIVKRCCGSPLAASALGSVLRTKTTVKEWNAIASRSSICTEETGILPILKLSYNDLPSHMKQCFAFCAVFPKDYKIDVAKLIQLWIANGFIPEHKEDSLETIGQLIFDELASRSFFLDIEKSKEDWEYYSRTTCKIHDLMHDIAMSVMEKECVVATMEPSEIEWLPDTARHLFLSCEETERILNDSMEERSPAIQTLLCDSNVFSPLKHLSKYSSLHALKLCIRGTESFLLKPKYLHHLRYLDLSESSIKALPEDISILYNLQVLDLSYCNYLDRLPRQMKYMTSLCHLYTHGCRNLKSMPPGLENLTKLQTLTVFVAGVPGPDCADVGELHGLNIGGRLELCQVENVEKAEAEVANLGGQLELQHLNLGDQLELRRVENVKKAEAKVANLGNKKDLRELTLRWTEVGDSKVLDKFEPHGGLQVLKIYKYGGKCMGMLQNMVEIHLSGCERLQVLFSCGTSFTFPKLKVLTLEHLLDFERWWEINEAQEEQIIFPLLEKLFIRHCGKLIALPEAPLLGEPSRGGNRLVCTPFSLLENLFIWYCGKLVPLREAPLVHESCSGGYRLVQSAFPALKVLALEDLGSFQKWDAAVEGEPILFPQLETLSVQKCPKLVDLPEAPKLSVLVIEDGKQEVFHFVDRYLSSLTNLTLRLEHRETTSEAECTSIVPVDSKEKWNQKSPLTVLELGCCNSFFGPGALEPWDYFVHLEKLEIDRCDVLVHWPENVFQSLVSLRTLLIRNCKNLTGYAQAPLEPLASERSQHPRGLESLCLRNCPSLVEMFNVPASLKKMTIGGCIKLESIFGKQQGMAELVQVSSSSEAIMPATVSELPSTPMNHFCPCLEDLCLSACGSLPAVLNLPPSLKTLEMDRCSSIQVLSCQLGGLQKPEATTSRSRSPIMPQPLAAATAPAAREHLLPPHLEYLTILNCAGMLGGTLRLPAPLKRLFIIGNSGLTSLECLSGEHPPSLESLWLERCSTLASLPNEPQVYRSLWSLEITGCPAIKKLPRCLQQQLGSIKRKWLDARYEVTEFKPLKPKTWKEIPR

superfamily: SSF52540
166-396 SSF52540

YVSIDPQEIASRSRHEDKKNIIGILVDEASNADLTVVPVVAMGGLGKTTLAQLIYNDPEIQKHFQLLLWVCVSDTFDVNSLAKSIVEASPNKNVDTDKPPLARLQKLVSGQRYLLVLDDVWDNKELRKWERLKVCLQHGGMGSAVLTTTRDKRVAEIMGADRAAYNLNALEDHFIKEIIVDRAFSSENGKIPELLEMVGEIVKRCCGSPLAASALGSVLRTKTTVKEWNAI

HMMPfam: PF00931
IPR002182
181-458 NB-ARC,NBS
NB-ARC

EDKKNIIGILVDEASNADLTVVPVVAMGGLGKTTLAQLIYNDPEIQKHFQLLLWVCVSDTFDVNSLAKSIVEASPNKNVDTDKPPLARLQKLVSGQRYLLVLDDVWDNKELRKWERLKVCLQHGGMGSAVLTTTRDKRVAEIMGADRAAYNLNALEDHFIKEIIVDRAFSSENGKIPELLEMVGEIVKRCCGSPLAASALGSVLRTKTTVKEWNAIASRSSICTEETGILPILKLSYNDLPSHMKQCFAFCAVFPKDYKIDVAKLIQLWIANGFIPEH

FPrintScan: PR00364
IPR000767
201-216 DISEASERSIST
Disease resistance protein

VVPVVAMGGLGKTTLA

FPrintScan: PR00364
IPR000767
272-286 DISEASERSIST
Disease resistance protein

LVSGQRYLLVLDDVW

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

CCGSPLAASALGSVL

superfamily: SSF52058
499-1020 SSF52058,LRR

KIHDLMHDIAMSVMEKECVVATMEPSEIEWLPDTARHLFLSCEETERILNDSMEERSPAIQTLLCDSNVFSPLKHLSKYSSLHALKLCIRGTESFLLKPKYLHHLRYLDLSESSIKALPEDISILYNLQVLDLSYCNYLDRLPRQMKYMTSLCHLYTHGCRNLKSMPPGLENLTKLQTLTVFVAGVPGPDCADVGELHGLNIGGRLELCQVENVEKAEAEVANLGGQLELQHLNLGDQLELRRVENVKKAEAKVANLGNKKDLRELTLRWTEVGDSKVLDKFEPHGGLQVLKIYKYGGKCMGMLQNMVEIHLSGCERLQVLFSCGTSFTFPKLKVLTLEHLLDFERWWEINEAQEEQIIFPLLEKLFIRHCGKLIALPEAPLLGEPSRGGNRLVCTPFSLLENLFIWYCGKLVPLREAPLVHESCSGGYRLVQSAFPALKVLALEDLGSFQKWDAAVEGEPILFPQLETLSVQKCPKLVDLPEAPKLSVLVIEDGKQEVFHFVDRYLSSLTNLTLRLEHRET

Gene3D: G3DSA:3.80.10.10
555-621 G3DSA:3.80.10.10

SPAIQTLLCDSNVFSPLKHLSKYSSLHALKLCIRGTESFLLKPKYLHHLRYLDLSESSIKALPEDIS

FPrintScan: PR00364
IPR000767
621-637 DISEASERSIST
Disease resistance protein

SILYNLQVLDLSYCNYL

Gene3D: G3DSA:3.80.10.10
622-677 G3DSA:3.80.10.10

ILYNLQVLDLSYCNYLDRLPRQMKYMTSLCHLYTHGCRNLKSMPPGLENLTKLQTL

Gene3D: G3DSA:3.80.10.10
742-890 G3DSA:3.80.10.10

VENVKKAEAKVANLGNKKDLRELTLRWTEVGDSKVLDKFEPHGGLQVLKIYKYGGKCMGMLQNMVEIHLSGCERLQVLFSCGTSFTFPKLKVLTLEHLLDFERWWEINEAQEEQIIFPLLEKLFIRHCGKLIALPEAPLLGEPSRGGNR

Gene3D: G3DSA:3.80.10.10
934-1026 G3DSA:3.80.10.10

FPALKVLALEDLGSFQKWDAAVEGEPILFPQLETLSVQKCPKLVDLPEAPKLSVLVIEDGKQEVFHFVDRYLSSLTNLTLRLEHRETTSEAEC

Gene3D: G3DSA:3.80.10.10
1042-1151 G3DSA:3.80.10.10

SPLTVLELGCCNSFFGPGALEPWDYFVHLEKLEIDRCDVLVHWPENVFQSLVSLRTLLIRNCKNLTGYAQAPLEPLASERSQHPRGLESLCLRNCPSLVEMFNVPASLKK

superfamily: SSF52047
1042-1411 SSF52047,LRR

SPLTVLELGCCNSFFGPGALEPWDYFVHLEKLEIDRCDVLVHWPENVFQSLVSLRTLLIRNCKNLTGYAQAPLEPLASERSQHPRGLESLCLRNCPSLVEMFNVPASLKKMTIGGCIKLESIFGKQQGMAELVQVSSSSEAIMPATVSELPSTPMNHFCPCLEDLCLSACGSLPAVLNLPPSLKTLEMDRCSSIQVLSCQLGGLQKPEATTSRSRSPIMPQPLAAATAPAAREHLLPPHLEYLTILNCAGMLGGTLRLPAPLKRLFIIGNSGLTSLECLSGEHPPSLESLWLERCSTLASLPNEPQVYRSLWSLEITGCPAIKKLPRCLQQQLGSIKRKWLDARYEVTEFKPLKPKTWKEIPRLVRERRQ

Gene3D: G3DSA:3.80.10.10
1200-1242 G3DSA:3.80.10.10

CPCLEDLCLSACGSLPAVLNLPPSLKTLEMDRCSSIQVLSCQL

Gene3D: G3DSA:3.80.10.10
1279-1362 G3DSA:3.80.10.10

PHLEYLTILNCAGMLGGTLRLPAPLKRLFIIGNSGLTSLECLSGEHPPSLESLWLERCSTLASLPNEPQVYRSLWSLEITGCPA


Diseases

Disease Pathogen Avirulence gene
Powdery mildew Blumeria graminis

List of References

Nabila Yahiaoui, Payorm Srichumpa, Robert Dudler, Beat Keller
Genome analysis at different ploidy levels allows cloning of the powdery mildew resistance gene Pm3b from hexaploid wheat.
Plant J.: 2004, 37(4);528-38
PubMed:14756761 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox