PRGDB00061438 (Pm3)

From PRG Wiki
Jump to: navigation, search
Pm3
Gene Type Reference_R-Genes,_manually_curated
GenBank 37624723 (AY325736)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum powdery mildew resistance protein PM3b (Pm3) gene, Pm3-b allele, complete cds.

DNA Sequence

ATGGCAGAGCGGGTGGTCACCATGGCGATCGGGCCACTGGTGTCCATGCTGAAGGACAAGGCGTCCAGCTACCTCCTGGACCAGTACAAGGTCATGGAGGGAATGGAGGAGCAGCACAAGATTCTCAAACGCAAGCTTCCGGCCATCCTCGACGTCATCACCGATGTCGAGGAGCAGGCCATGGCACAGAGAGAAGGTGCCAAAGCCTGGCTTCAGGAGCTCAGGACAGTCGCCTATGTGGCAAATGAAGTCTTCGACGAATTCAAGTACGAAGCCCTACGCCGTGAAGCCAAGAAGAATGGGCACTACATAAAGCTCGGCTTCGATGTAATTAAACTCTTCCCTACTCACAACCGTGTTGCGTTCCGTTACAAAATGGGTCGCAAGCTTTGCCTGATTCTGCAAGCCGTTGAGGTCCTCATAGCAGAGATGCAGGTCTTTGGGTTCAAGTACCAACCACAGCCACCGGTGTCCAAAGAGTGGAGGCATACAGATTATGTTAGCATTGACCCACAAGAAATTGCCAGCAGATCCAGACACGAAGATAAGAAGAACATTATTGGTATACTAGTTGATGAAGCTAGCAATGCAGATCTCACAGTTGTTCCTGTGGTTGCAATGGGGGGCCTTGGCAAGACCACATTAGCGCAACTCATATACAATGATCCTGAAATTCAGAAGCATTTCCAGTTGCTGCTCTGGGTTTGTGTCTCTGATACCTTTGATGTGAACTCCCTGGCCAAGAGTATAGTTGAAGCATCCCCCAATAAGAATGTTGATACAGACAAACCACCATTGGCTAGACTTCAAAAACTGGTCAGCGGACAGCGGTATCTCCTTGTATTGGATGATGTTTGGGACAACAAAGAGTTACGTAAGTGGGAAAGGCTGAAGGTATGTCTTCAGCATGGTGGCATGGGCAGTGCAGTGTTGACAACAACTCGTGATAAACGAGTTGCTGAAATTATGGGTGCAGATAGGGCAGCCTACAATCTCAATGCTTTGGAGGATCACTTCATAAAGGAAATTATTGTGGATAGAGCATTCAGTTCAGAGAATGGAAAGATTCCCGAGCTACTCGAGATGGTTGGTGAGATTGTGAAGAGATGTTGTGGCTCTCCATTAGCTGCAAGTGCACTGGGCTCTGTACTTCGTACCAAGACCACCGTGAAAGAATGGAATGCTATAGCATCTAGAAGCAGCATTTGCACTGAGGAAACTGGAATCTTGCCAATACTCAAGCTTAGCTACAACGACTTGCCATCGCACATGAAGCAGTGCTTTGCTTTTTGTGCTGTATTTCCAAAGGATTACAAGATTGATGTAGCGAAGTTGATCCAACTATGGATCGCAAATGGCTTTATCCCTGAACACAAGGAAGATAGTCTTGAAACCATTGGACAACTTATTTTTGATGAGCTTGCTTCAAGGTCATTCTTTCTGGATATAGAGAAGAGTAAAGAAGACTGGGAGTATTATTCCAGAACAACATGTAAAATCCACGATCTTATGCATGATATTGCAATGTCTGTTATGGAAAAGGAATGTGTTGTTGCAACTATGGAACCAAGTGAAATTGAGTGGCTTCCAGATACTGCTCGGCATTTGTTCTTGTCATGTGAAGAAACGGAACGTATTTTGAATGATTCTATGGAGGAAAGATCCCCTGCTATTCAAACATTGCTATGTGATAGTAATGTGTTCAGCCCATTGAAGCATCTATCAAAATATAGCTCTTTGCACGCCTTGAAGCTCTGTATTAGAGGCACAGAATCATTTCTACTCAAACCAAAGTATCTGCATCACCTGAGGTACCTTGATCTCTCAGAAAGTTCTATCAAAGCACTTCCTGAGGATATAAGTATTCTATATAACCTGCAAGTGTTGGACCTTTCCTACTGTAATTATCTTGATCGACTTCCAAGGCAAATGAAGTATATGACTTCCCTCTGCCACCTCTACACTCATGGATGTCGGAACTTGAAGAGCATGCCTCCAGGACTTGAAAATCTCACTAAGCTGCAGACACTCACAGTTTTTGTAGCAGGAGTTCCTGGCCCTGATTGCGCTGATGTTGGAGAGCTGCATGGTCTAAACATTGGTGGTCGGCTAGAGCTATGCCAGGTAGAGAATGTTGAAAAAGCAGAAGCAGAAGTGGCAAACCTTGGTGGTCAGCTAGAGCTGCAGCATTTAAACCTTGGTGATCAGCTAGAGCTACGCCGGGTAGAGAATGTTAAAAAAGCAGAGGCAAAAGTGGCGAATCTTGGAAACAAGAAGGATCTCCGTGAACTGACATTAAGATGGACTGAGGTTGGCGACAGCAAGGTGCTCGACAAGTTCGAACCTCATGGTGGGCTGCAGGTTCTGAAGATATATAAATATGGAGGGAAGTGTATGGGTATGTTGCAAAACATGGTTGAGATCCATCTTTCTGGTTGTGAAAGATTGCAGGTTTTGTTCAGTTGTGGTACATCCTTCACGTTTCCAAAACTGAAGGTGCTTACACTAGAGCATTTATTGGATTTTGAGAGATGGTGGGAAATAAATGAGGCACAAGAAGAACAGATAATATTTCCTCTGCTTGAGAAGTTGTTTATTCGGCATTGTGGAAAGCTGATAGCATTACCTGAAGCACCATTGCTTGGAGAACCAAGTCGTGGAGGTAATAGACTGGTATGCACACCATTTTCTCTGCTTGAGAACTTGTTTATTTGGTATTGTGGAAAGCTGGTACCATTGCGTGAAGCACCACTGGTTCATGAAAGTTGTAGTGGAGGTTATAGGTTGGTACAGTCAGCATTTCCTGCTCTAAAGGTACTTGCATTGGAAGACTTGGGGAGTTTTCAGAAATGGGATGCTGCTGTCGAAGGAGAACCGATATTGTTTCCTCAGCTTGAGACACTATCAGTTCAGAAATGCCCAAAGCTAGTAGATTTACCCGAAGCACCAAAACTCAGTGTACTAGTAATTGAAGATGGCAAGCAAGAGGTGTTCCATTTTGTAGACAGGTATTTATCTTCATTGACCAATCTGACACTGAGGCTAGAACACAGAGAAACAACATCAGAGGCTGAATGCACTTCAATTGTACCTGTGGACAGCAAAGAGAAATGGAACCAGAAATCCCCTCTTACAGTTCTGGAGTTAGGATGCTGCAACTCATTCTTTGGACCAGGTGCACTAGAGCCGTGGGACTATTTTGTACACCTTGAAAAGTTGGAAATTGATAGATGTGATGTGCTCGTCCACTGGCCAGAGAATGTGTTCCAAAGCTTGGTATCCTTGAGGACATTACTGATTAGAAACTGCAAAAATCTGACTGGATATGCACAAGCTCCTCTTGAGCCGTTGGCGTCTGAAAGGAGTCAGCACCCGAGAGGTCTGGAGTCTCTTTGCTTAAGAAACTGCCCAAGTTTAGTAGAGATGTTCAACGTCCCGGCATCTCTCAAGAAAATGACTATTGGTGGGTGCATTAAGCTTGAGTCCATATTCGGCAAGCAACAGGGCATGGCAGAGTTAGTCCAAGTATCTTCTAGCAGTGAGGCAATCATGCCTGCAACTGTATCAGAGTTGCCATCCACACCCATGAATCACTTTTGTCCATGCCTAGAAGATCTATGCTTATCAGCATGTGGAAGCTTACCAGCGGTTCTAAATCTGCCTCCATCCTTAAAGACCTTAGAAATGGATCGTTGTAGTAGTATTCAAGTCCTATCATGCCAGCTGGGTGGGCTCCAGAAACCAGAAGCCACTACCTCCAGAAGCAGAAGTCCTATCATGCCACAGCCACTAGCAGCAGCAACAGCACCAGCTGCAAGAGAGCATTTACTTCCTCCCCATCTCGAATATCTAACAATACTGAACTGTGCTGGCATGTTGGGTGGGACTCTCCGTCTGCCTGCACCCCTCAAGAGACTGTTCATTATTGGCAACAGTGGGCTGACATCGCTGGAGTGTCTGTCGGGAGAGCACCCCCCATCGCTGGAATCCCTTTGGCTTGAAAGATGCAGTACCCTGGCATCCCTGCCGAATGAGCCGCAAGTATACAGGTCTCTCTGGTCTCTTGAAATTACAGGCTGCCCTGCTATAAAGAAGCTCCCTAGATGCCTGCAGCAGCAACTGGGCAGCATCAAACGCAAATGGCTAGATGCCCGTTATGAAGTAACGGAATTCAAACCATTGAAACCGAAGACATGGAAGGAAATACCGAGGCTAGTCCGTGAGCGGAGGCAGGCCTGCCGGAGCTGA


Protein sequences

Name Description Sequence
powdery mildew resistance protein PM3b powdery mildew resistance protein PM3b [Triticum aestivum].

MAERVVTMAIGPLVSMLKDKASSYLLDQYKVMEGMEEQHKILKRKLPAILDVITDVEEQAMAQREGAKAWLQELRTVAYVANEVFDEFKYEALRREAKKNGHYIKLGFDVIKLFPTHNRVAFRYKMGRKLCLILQAVEVLIAEMQVFGFKYQPQPPVSKEWRHTDYVSIDPQEIASRSRHEDKKNIIGILVDEASNADLTVVPVVAMGGLGKTTLAQLIYNDPEIQKHFQLLLWVCVSDTFDVNSLAKSIVEASPNKNVDTDKPPLARLQKLVSGQRYLLVLDDVWDNKELRKWERLKVCLQHGGMGSAVLTTTRDKRVAEIMGADRAAYNLNALEDHFIKEIIVDRAFSSENGKIPELLEMVGEIVKRCCGSPLAASALGSVLRTKTTVKEWNAIASRSSICTEETGILPILKLSYNDLPSHMKQCFAFCAVFPKDYKIDVAKLIQLWIANGFIPEHKEDSLETIGQLIFDELASRSFFLDIEKSKEDWEYYSRTTCKIHDLMHDIAMSVMEKECVVATMEPSEIEWLPDTARHLFLSCEETERILNDSMEERSPAIQTLLCDSNVFSPLKHLSKYSSLHALKLCIRGTESFLLKPKYLHHLRYLDLSESSIKALPEDISILYNLQVLDLSYCNYLDRLPRQMKYMTSLCHLYTHGCRNLKSMPPGLENLTKLQTLTVFVAGVPGPDCADVGELHGLNIGGRLELCQVENVEKAEAEVANLGGQLELQHLNLGDQLELRRVENVKKAEAKVANLGNKKDLRELTLRWTEVGDSKVLDKFEPHGGLQVLKIYKYGGKCMGMLQNMVEIHLSGCERLQVLFSCGTSFTFPKLKVLTLEHLLDFERWWEINEAQEEQIIFPLLEKLFIRHCGKLIALPEAPLLGEPSRGGNRLVCTPFSLLENLFIWYCGKLVPLREAPLVHESCSGGYRLVQSAFPALKVLALEDLGSFQKWDAAVEGEPILFPQLETLSVQKCPKLVDLPEAPKLSVLVIEDGKQEVFHFVDRYLSSLTNLTLRLEHRETTSEAECTSIVPVDSKEKWNQKSPLTVLELGCCNSFFGPGALEPWDYFVHLEKLEIDRCDVLVHWPENVFQSLVSLRTLLIRNCKNLTGYAQAPLEPLASERSQHPRGLESLCLRNCPSLVEMFNVPASLKKMTIGGCIKLESIFGKQQGMAELVQVSSSSEAIMPATVSELPSTPMNHFCPCLEDLCLSACGSLPAVLNLPPSLKTLEMDRCSSIQVLSCQLGGLQKPEATTSRSRSPIMPQPLAAATAPAAREHLLPPHLEYLTILNCAGMLGGTLRLPAPLKRLFIIGNSGLTSLECLSGEHPPSLESLWLERCSTLASLPNEPQVYRSLWSLEITGCPAIKKLPRCLQQQLGSIKRKWLDARYEVTEFKPLKPKTWKEIPRLVRERRQACRS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
6-1404 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTMAIGPLVSMLKDKASSYLLDQYKVMEGMEEQHKILKRKLPAILDVITDVEEQAMAQREGAKAWLQELRTVAYVANEVFDEFKYEALRREAKKNGHYIKLGFDVIKLFPTHNRVAFRYKMGRKLCLILQAVEVLIAEMQVFGFKYQPQPPVSKEWRHTDYVSIDPQEIASRSRHEDKKNIIGILVDEASNADLTVVPVVAMGGLGKTTLAQLIYNDPEIQKHFQLLLWVCVSDTFDVNSLAKSIVEASPNKNVDTDKPPLARLQKLVSGQRYLLVLDDVWDNKELRKWERLKVCLQHGGMGSAVLTTTRDKRVAEIMGADRAAYNLNALEDHFIKEIIVDRAFSSENGKIPELLEMVGEIVKRCCGSPLAASALGSVLRTKTTVKEWNAIASRSSICTEETGILPILKLSYNDLPSHMKQCFAFCAVFPKDYKIDVAKLIQLWIANGFIPEHKEDSLETIGQLIFDELASRSFFLDIEKSKEDWEYYSRTTCKIHDLMHDIAMSVMEKECVVATMEPSEIEWLPDTARHLFLSCEETERILNDSMEERSPAIQTLLCDSNVFSPLKHLSKYSSLHALKLCIRGTESFLLKPKYLHHLRYLDLSESSIKALPEDISILYNLQVLDLSYCNYLDRLPRQMKYMTSLCHLYTHGCRNLKSMPPGLENLTKLQTLTVFVAGVPGPDCADVGELHGLNIGGRLELCQVENVEKAEAEVANLGGQLELQHLNLGDQLELRRVENVKKAEAKVANLGNKKDLRELTLRWTEVGDSKVLDKFEPHGGLQVLKIYKYGGKCMGMLQNMVEIHLSGCERLQVLFSCGTSFTFPKLKVLTLEHLLDFERWWEINEAQEEQIIFPLLEKLFIRHCGKLIALPEAPLLGEPSRGGNRLVCTPFSLLENLFIWYCGKLVPLREAPLVHESCSGGYRLVQSAFPALKVLALEDLGSFQKWDAAVEGEPILFPQLETLSVQKCPKLVDLPEAPKLSVLVIEDGKQEVFHFVDRYLSSLTNLTLRLEHRETTSEAECTSIVPVDSKEKWNQKSPLTVLELGCCNSFFGPGALEPWDYFVHLEKLEIDRCDVLVHWPENVFQSLVSLRTLLIRNCKNLTGYAQAPLEPLASERSQHPRGLESLCLRNCPSLVEMFNVPASLKKMTIGGCIKLESIFGKQQGMAELVQVSSSSEAIMPATVSELPSTPMNHFCPCLEDLCLSACGSLPAVLNLPPSLKTLEMDRCSSIQVLSCQLGGLQKPEATTSRSRSPIMPQPLAAATAPAAREHLLPPHLEYLTILNCAGMLGGTLRLPAPLKRLFIIGNSGLTSLECLSGEHPPSLESLWLERCSTLASLPNEPQVYRSLWSLEITGCPAIKKLPRCLQQQLGSIKRKWLDARYEVTEFKPLKPKTWKEIPR

HMMPanther: PTHR23155:SF138
6-1404 PTHR23155:SF138,OS03G0848700 PROTEIN

VTMAIGPLVSMLKDKASSYLLDQYKVMEGMEEQHKILKRKLPAILDVITDVEEQAMAQREGAKAWLQELRTVAYVANEVFDEFKYEALRREAKKNGHYIKLGFDVIKLFPTHNRVAFRYKMGRKLCLILQAVEVLIAEMQVFGFKYQPQPPVSKEWRHTDYVSIDPQEIASRSRHEDKKNIIGILVDEASNADLTVVPVVAMGGLGKTTLAQLIYNDPEIQKHFQLLLWVCVSDTFDVNSLAKSIVEASPNKNVDTDKPPLARLQKLVSGQRYLLVLDDVWDNKELRKWERLKVCLQHGGMGSAVLTTTRDKRVAEIMGADRAAYNLNALEDHFIKEIIVDRAFSSENGKIPELLEMVGEIVKRCCGSPLAASALGSVLRTKTTVKEWNAIASRSSICTEETGILPILKLSYNDLPSHMKQCFAFCAVFPKDYKIDVAKLIQLWIANGFIPEHKEDSLETIGQLIFDELASRSFFLDIEKSKEDWEYYSRTTCKIHDLMHDIAMSVMEKECVVATMEPSEIEWLPDTARHLFLSCEETERILNDSMEERSPAIQTLLCDSNVFSPLKHLSKYSSLHALKLCIRGTESFLLKPKYLHHLRYLDLSESSIKALPEDISILYNLQVLDLSYCNYLDRLPRQMKYMTSLCHLYTHGCRNLKSMPPGLENLTKLQTLTVFVAGVPGPDCADVGELHGLNIGGRLELCQVENVEKAEAEVANLGGQLELQHLNLGDQLELRRVENVKKAEAKVANLGNKKDLRELTLRWTEVGDSKVLDKFEPHGGLQVLKIYKYGGKCMGMLQNMVEIHLSGCERLQVLFSCGTSFTFPKLKVLTLEHLLDFERWWEINEAQEEQIIFPLLEKLFIRHCGKLIALPEAPLLGEPSRGGNRLVCTPFSLLENLFIWYCGKLVPLREAPLVHESCSGGYRLVQSAFPALKVLALEDLGSFQKWDAAVEGEPILFPQLETLSVQKCPKLVDLPEAPKLSVLVIEDGKQEVFHFVDRYLSSLTNLTLRLEHRETTSEAECTSIVPVDSKEKWNQKSPLTVLELGCCNSFFGPGALEPWDYFVHLEKLEIDRCDVLVHWPENVFQSLVSLRTLLIRNCKNLTGYAQAPLEPLASERSQHPRGLESLCLRNCPSLVEMFNVPASLKKMTIGGCIKLESIFGKQQGMAELVQVSSSSEAIMPATVSELPSTPMNHFCPCLEDLCLSACGSLPAVLNLPPSLKTLEMDRCSSIQVLSCQLGGLQKPEATTSRSRSPIMPQPLAAATAPAAREHLLPPHLEYLTILNCAGMLGGTLRLPAPLKRLFIIGNSGLTSLECLSGEHPPSLESLWLERCSTLASLPNEPQVYRSLWSLEITGCPAIKKLPRCLQQQLGSIKRKWLDARYEVTEFKPLKPKTWKEIPR

superfamily: SSF52540
166-396 SSF52540

YVSIDPQEIASRSRHEDKKNIIGILVDEASNADLTVVPVVAMGGLGKTTLAQLIYNDPEIQKHFQLLLWVCVSDTFDVNSLAKSIVEASPNKNVDTDKPPLARLQKLVSGQRYLLVLDDVWDNKELRKWERLKVCLQHGGMGSAVLTTTRDKRVAEIMGADRAAYNLNALEDHFIKEIIVDRAFSSENGKIPELLEMVGEIVKRCCGSPLAASALGSVLRTKTTVKEWNAI

HMMPfam: PF00931
IPR002182
181-458 NB-ARC,NBS
NB-ARC

EDKKNIIGILVDEASNADLTVVPVVAMGGLGKTTLAQLIYNDPEIQKHFQLLLWVCVSDTFDVNSLAKSIVEASPNKNVDTDKPPLARLQKLVSGQRYLLVLDDVWDNKELRKWERLKVCLQHGGMGSAVLTTTRDKRVAEIMGADRAAYNLNALEDHFIKEIIVDRAFSSENGKIPELLEMVGEIVKRCCGSPLAASALGSVLRTKTTVKEWNAIASRSSICTEETGILPILKLSYNDLPSHMKQCFAFCAVFPKDYKIDVAKLIQLWIANGFIPEH

FPrintScan: PR00364
IPR000767
201-216 DISEASERSIST
Disease resistance protein

VVPVVAMGGLGKTTLA

FPrintScan: PR00364
IPR000767
272-286 DISEASERSIST
Disease resistance protein

LVSGQRYLLVLDDVW

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

CCGSPLAASALGSVL

superfamily: SSF52058
499-1020 SSF52058,LRR

KIHDLMHDIAMSVMEKECVVATMEPSEIEWLPDTARHLFLSCEETERILNDSMEERSPAIQTLLCDSNVFSPLKHLSKYSSLHALKLCIRGTESFLLKPKYLHHLRYLDLSESSIKALPEDISILYNLQVLDLSYCNYLDRLPRQMKYMTSLCHLYTHGCRNLKSMPPGLENLTKLQTLTVFVAGVPGPDCADVGELHGLNIGGRLELCQVENVEKAEAEVANLGGQLELQHLNLGDQLELRRVENVKKAEAKVANLGNKKDLRELTLRWTEVGDSKVLDKFEPHGGLQVLKIYKYGGKCMGMLQNMVEIHLSGCERLQVLFSCGTSFTFPKLKVLTLEHLLDFERWWEINEAQEEQIIFPLLEKLFIRHCGKLIALPEAPLLGEPSRGGNRLVCTPFSLLENLFIWYCGKLVPLREAPLVHESCSGGYRLVQSAFPALKVLALEDLGSFQKWDAAVEGEPILFPQLETLSVQKCPKLVDLPEAPKLSVLVIEDGKQEVFHFVDRYLSSLTNLTLRLEHRET

Gene3D: G3DSA:3.80.10.10
555-621 G3DSA:3.80.10.10

SPAIQTLLCDSNVFSPLKHLSKYSSLHALKLCIRGTESFLLKPKYLHHLRYLDLSESSIKALPEDIS

FPrintScan: PR00364
IPR000767
621-637 DISEASERSIST
Disease resistance protein

SILYNLQVLDLSYCNYL

Gene3D: G3DSA:3.80.10.10
622-677 G3DSA:3.80.10.10

ILYNLQVLDLSYCNYLDRLPRQMKYMTSLCHLYTHGCRNLKSMPPGLENLTKLQTL

Gene3D: G3DSA:3.80.10.10
742-890 G3DSA:3.80.10.10

VENVKKAEAKVANLGNKKDLRELTLRWTEVGDSKVLDKFEPHGGLQVLKIYKYGGKCMGMLQNMVEIHLSGCERLQVLFSCGTSFTFPKLKVLTLEHLLDFERWWEINEAQEEQIIFPLLEKLFIRHCGKLIALPEAPLLGEPSRGGNR

Gene3D: G3DSA:3.80.10.10
934-1026 G3DSA:3.80.10.10

FPALKVLALEDLGSFQKWDAAVEGEPILFPQLETLSVQKCPKLVDLPEAPKLSVLVIEDGKQEVFHFVDRYLSSLTNLTLRLEHRETTSEAEC

Gene3D: G3DSA:3.80.10.10
1042-1151 G3DSA:3.80.10.10

SPLTVLELGCCNSFFGPGALEPWDYFVHLEKLEIDRCDVLVHWPENVFQSLVSLRTLLIRNCKNLTGYAQAPLEPLASERSQHPRGLESLCLRNCPSLVEMFNVPASLKK

superfamily: SSF52047
1042-1411 SSF52047,LRR

SPLTVLELGCCNSFFGPGALEPWDYFVHLEKLEIDRCDVLVHWPENVFQSLVSLRTLLIRNCKNLTGYAQAPLEPLASERSQHPRGLESLCLRNCPSLVEMFNVPASLKKMTIGGCIKLESIFGKQQGMAELVQVSSSSEAIMPATVSELPSTPMNHFCPCLEDLCLSACGSLPAVLNLPPSLKTLEMDRCSSIQVLSCQLGGLQKPEATTSRSRSPIMPQPLAAATAPAAREHLLPPHLEYLTILNCAGMLGGTLRLPAPLKRLFIIGNSGLTSLECLSGEHPPSLESLWLERCSTLASLPNEPQVYRSLWSLEITGCPAIKKLPRCLQQQLGSIKRKWLDARYEVTEFKPLKPKTWKEIPRLVRERRQ

Gene3D: G3DSA:3.80.10.10
1200-1242 G3DSA:3.80.10.10

CPCLEDLCLSACGSLPAVLNLPPSLKTLEMDRCSSIQVLSCQL

Gene3D: G3DSA:3.80.10.10
1279-1362 G3DSA:3.80.10.10

PHLEYLTILNCAGMLGGTLRLPAPLKRLFIIGNSGLTSLECLSGEHPPSLESLWLERCSTLASLPNEPQVYRSLWSLEITGCPA


Diseases

Disease Pathogen Avirulence gene
Powdery mildew Blumeria graminis

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox