PRGDB00061439 (Lr10)

From PRG Wiki
Jump to: navigation, search
Lr10
Gene Type Reference_R-Genes,_manually_curated
GenBank 33302326 (AY270157)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum resistance protein LR10 gene, complete cds.

DNA Sequence

ATGGCACCATGTCTGGTGAGCGCATCTACGGGAGCAATGGGTTCCCTCCTGACAAAGTTGGAAACCATGCTAGATGACGAATACATCCTGCTCAATGTTCGCCGCGACATCAAGTTCGTCATACATGAGCTTGCTATGTGGCAATCATTTCTCCTCGATGTGGCGGACACGGAGGAACCTGGACAGCATGACAAGAGTTGTGCTGACTTAGTGCGGGAGCTCTCATATGATATTGAGGACAAGATTGACAACTCCATGTCACTTATGCTCCATCACGCCTGTCCCAAGAGTGGCATCAAGAAGCACATGAGCAAATTCAAGAACTTGTTACCTGTCAAGATCCCGTATCAGATAGCCAAAGATATAAAAGACATCAAGAGCCAAATCTTGGAGGTCAGTAATAGATGTGAAAGATACAGGTTTGAGGATGTCTGCCTCGCAAGAACAGAATTCGTTGACCCTAGATTGTGCACTGTCGATACATGTGCAGCCGACCTTGTAGGCATTGATGGTCCGAAACATGAGCTTGTTAAGTGGCTAAGAAACGGGGAGGATGAATCGGTGCATCAACAGAAGGTTGTCTCTATTGTTGGTTGTGCGGGATTAGGGAAGACGACTCTTGCCAAACAGGTCTACGACGAGCTTAGAATAAACTTTGAATATCGGGCTTTTGTATCAATTTCACGAAGCCCTAATATGGCAACCATTTTAAAATGTGTACTGTCTCAATTCCACGCTCAAGATTATTCTTCCGATGAAAGCGAGATTCCAAAACTCGTCGATCAAATCAGAGATCTCCTACAAGATAAAAGGTACTTTGTGATAATCGATGATATATGGGATATGAAGACATGGGATGTTTTGAAATGTGCGTTATGCAAGAATAGTTGTGGCAGTGTAATAATGACCACAACACGTATTTATGATGTAGCTAAATCATGTTGCTCTTCTAACGGGGATCTTGTCTACAATATCCAACCACTTAGTGTTGCTGACTCGGAGGAGCTATTTTTGAACCGAGTATTTGGTCACGAAAAGGGATTTCCCCCTGAATTGAAAGAAGTCTCGAAGGATGTCTTAAGAAAATGTGGTGGTTTACCACTGGCCATCAATGCCATATCTAGCTTGCTGGCTGCTGAGAAAATCGAAGAGTGGGATCGCGTGGGACTCTCTAATGTCTTTGCACAAGGAGAAAAATCTGACATTGATGCTATGAAATACAAATTATCTCTGTGTTATTTTGACCTTCCCCTCCATCTAAGAAGTTGTTTATTGTATTTGATTATGTTTCCTGAAGATTGTTTGATTGAAAAGGAGCGGTTAGTACACAGATGGATTTCAGAGGGCTTCATTCGCAATGAAGATGGGGAAGATCTTGTTGAAGTAGGAGAGAGATATTTATATGAGCTTGTTAACAGAAGTTTAATAGAATCAGTGGGCGTGCCATATGATGGTAAGGCACGGTTCTACAGAGTCCACAATGTTATCCTTGATTTCCTCATGATAAAGTCCATGGAAGAGAATTTTTGTACTTTGACAAGTAATCAATCAAGGCTAGATTACAAAGTACGTCGTCTCTCTCTGTTTGCAAATAAAGATCCATCATGTATCGCACAACTGGATTTATCGCATGCTCGATCTCTCGGTGCTTCTGGGCATCTTGGGCAATTAATTTCCTCTGTGAAGTCAAATGCTCTGCGTGTGCTCGACGTACAAGATTGCTCGGAGTTGGGGAATCATCATGTCAAAGATATTGGAAGAAATCCTCTATTAAGGTACTTGAACATCTCTGGAACAGATGTAACTGAGCTTCCCATACAGATTGGAGATATGGGGTTCCTAGAAACACTTGATGCATCATTTACGGAATTAGTTGAGATGCCTGGATCCATTACTCGTCTAAGACAACTGCAGCGTCTGTTTGTTTCAGATGAAACTAAATTGCCTGATGAGATTGGAAATATGAAGAGGTTGCAAGAGCTTGGTGATATAAATGCCTTCAAGCAATCCGTTAACTTTCTGAATGAGCTGGGCAAATTAACGGGTTTGCGTAAGCTGGGAATTATTTGGGACACCAATGATATTCTTAAATCTGGCAAGGGAAGTTCCAAGGAAAAAAGGTTGGTGTCCTCCCTCTCTAAATTGGATGCAGGCAGACTTAGCAACCTCTATGTTACATTTTATTTGAGAGAAAAGGATGGCTTCATAGGACATCCGTTCTTGCCTGCTCTCAATAGCATCCGAGAGGTCTATCTCCGCCGTGGACGCATGTGTTGGATGAACAAATGGCTGCTTTCACTTGCCAACCTAGAAAAATTATATATCAGTGGTGGGGATGAGATAGAGCAAGATGATCTGCGTACAGTTGGAAGCATACCAACTCTGGTTGAATTCAAGCTTTACTCTGGCTGCTTAGGGCCTATCATCATAAGTTCAGGATTTGAACAGTTAGAAAGGCTCGAGTTGAAGTTCAGTTTTTCGCAGCTGACGTTTGAAGTGGGCGCTATGCCTAACCTGAAGAAACTTGATCTCCATGTTTATTTATCAAAGTTCAAATCTGCTGGTGCTGGTTTTGATTTTGGCATCCAGCATCTCTCCAGCCTTGCTTGCGTTTCTATTGTCATATTTTGCGAGGGCGTCAGTGCTGCCTATGTGGAGGCAGCGGAGGGAGCTTTCAAGAGCATGGTCAATGCACACCCCAACCCCAACCGGCCCATGCTGGAAATGACTAGAGAATCTGCGGACTTCATGTCACAGGATGAGTGA


Protein sequences

Name Description Sequence
resistance protein LR10 resistance protein LR10 [Triticum aestivum].

MAPCLVSASTGAMGSLLTKLETMLDDEYILLNVRRDIKFVIHELAMWQSFLLDVADTEEPGQHDKSCADLVRELSYDIEDKIDNSMSLMLHHACPKSGIKKHMSKFKNLLPVKIPYQIAKDIKDIKSQILEVSNRCERYRFEDVCLARTEFVDPRLCTVDTCAADLVGIDGPKHELVKWLRNGEDESVHQQKVVSIVGCAGLGKTTLAKQVYDELRINFEYRAFVSISRSPNMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMKTWDVLKCALCKNSCGSVIMTTTRIYDVAKSCCSSNGDLVYNIQPLSVADSEELFLNRVFGHEKGFPPELKEVSKDVLRKCGGLPLAINAISSLLAAEKIEEWDRVGLSNVFAQGEKSDIDAMKYKLSLCYFDLPLHLRSCLLYLIMFPEDCLIEKERLVHRWISEGFIRNEDGEDLVEVGERYLYELVNRSLIESVGVPYDGKARFYRVHNVILDFLMIKSMEENFCTLTSNQSRLDYKVRRLSLFANKDPSCIAQLDLSHARSLGASGHLGQLISSVKSNALRVLDVQDCSELGNHHVKDIGRNPLLRYLNISGTDVTELPIQIGDMGFLETLDASFTELVEMPGSITRLRQLQRLFVSDETKLPDEIGNMKRLQELGDINAFKQSVNFLNELGKLTGLRKLGIIWDTNDILKSGKGSSKEKRLVSSLSKLDAGRLSNLYVTFYLREKDGFIGHPFLPALNSIREVYLRRGRMCWMNKWLLSLANLEKLYISGGDEIEQDDLRTVGSIPTLVEFKLYSGCLGPIIISSGFEQLERLELKFSFSQLTFEVGAMPNLKKLDLHVYLSKFKSAGAGFDFGIQHLSSLACVSIVIFCEGVSAAYVEAAEGAFKSMVNAHPNPNRPMLEMTRESADFMSQDE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
19-688 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KLETMLDDEYILLNVRRDIKFVIHELAMWQSFLLDVADTEEPGQHDKSCADLVRELSYDIEDKIDNSMSLMLHHACPKSGIKKHMSKFKNLLPVKIPYQIAKDIKDIKSQILEVSNRCERYRFEDVCLARTEFVDPRLCTVDTCAADLVGIDGPKHELVKWLRNGEDESVHQQKVVSIVGCAGLGKTTLAKQVYDELRINFEYRAFVSISRSPNMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMKTWDVLKCALCKNSCGSVIMTTTRIYDVAKSCCSSNGDLVYNIQPLSVADSEELFLNRVFGHEKGFPPELKEVSKDVLRKCGGLPLAINAISSLLAAEKIEEWDRVGLSNVFAQGEKSDIDAMKYKLSLCYFDLPLHLRSCLLYLIMFPEDCLIEKERLVHRWISEGFIRNEDGEDLVEVGERYLYELVNRSLIESVGVPYDGKARFYRVHNVILDFLMIKSMEENFCTLTSNQSRLDYKVRRLSLFANKDPSCIAQLDLSHARSLGASGHLGQLISSVKSNALRVLDVQDCSELGNHHVKDIGRNPLLRYLNISGTDVTELPIQIGDMGFLETLDASFTELVEMPGSITRLRQLQRLFVSDETKLPDEIGNMKRLQELGDINAFKQSVNFLNELGKLTGLRKLGI

HMMPanther: PTHR11017:SF126
19-688 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

KLETMLDDEYILLNVRRDIKFVIHELAMWQSFLLDVADTEEPGQHDKSCADLVRELSYDIEDKIDNSMSLMLHHACPKSGIKKHMSKFKNLLPVKIPYQIAKDIKDIKSQILEVSNRCERYRFEDVCLARTEFVDPRLCTVDTCAADLVGIDGPKHELVKWLRNGEDESVHQQKVVSIVGCAGLGKTTLAKQVYDELRINFEYRAFVSISRSPNMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMKTWDVLKCALCKNSCGSVIMTTTRIYDVAKSCCSSNGDLVYNIQPLSVADSEELFLNRVFGHEKGFPPELKEVSKDVLRKCGGLPLAINAISSLLAAEKIEEWDRVGLSNVFAQGEKSDIDAMKYKLSLCYFDLPLHLRSCLLYLIMFPEDCLIEKERLVHRWISEGFIRNEDGEDLVEVGERYLYELVNRSLIESVGVPYDGKARFYRVHNVILDFLMIKSMEENFCTLTSNQSRLDYKVRRLSLFANKDPSCIAQLDLSHARSLGASGHLGQLISSVKSNALRVLDVQDCSELGNHHVKDIGRNPLLRYLNISGTDVTELPIQIGDMGFLETLDASFTELVEMPGSITRLRQLQRLFVSDETKLPDEIGNMKRLQELGDINAFKQSVNFLNELGKLTGLRKLGI

superfamily: SSF52540
149-393 P-loop containing nucleoside triphosphate hydrolases

TEFVDPRLCTVDTCAADLVGIDGPKHELVKWLRNGEDESVHQQKVVSIVGCAGLGKTTLAKQVYDELRINFEYRAFVSISRSPNMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMKTWDVLKCALCKNSCGSVIMTTTRIYDVAKSCCSSNGDLVYNIQPLSVADSEELFLNRVFGHEKGFPPELKEVSKDVLRKCGGLPLAINAISSLLAAEKIEEWDRVGLSNV

Gene3D: G3DSA:3.40.50.300
164-283 no description

ADLVGIDGPKHELVKWLRNGEDESVHQQKVVSIVGCAGLGKTTLAKQVYDELRINFEYRAFVSISRSPNMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMK

HMMPfam: PF00931
IPR002182
174-455 NB-ARC,NBS
NB-ARC

HELVKWLRNGEDESVHQQKVVSIVGCAGLGKTTLAKQVYDELRINFEYRAFVSISRSPNMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMKTWDVLKCALCKNSCGSVIMTTTRIYDVAKSCCSSNGDLVYNIQPLSVADSEELFLNRVFGHEKGFPPELKEVSKDVLRKCGGLPLAINAISSLLAAEKIEEWDRVGLSNVFAQGEKSDIDAMKYKLSLCYFDLPLHLRSCLLYLIMFPEDCLIEKERLVHRWISEGFIRNED

FPrintScan: PR00364
IPR000767
193-208 DISEASERSIST
Disease resistance protein

VVSIVGCAGLGKTTLA

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

LLQDKRYFVIIDDIW

FPrintScan: PR00364
IPR000767
363-377 DISEASERSIST
Disease resistance protein

CGGLPLAINAISSLL

Seg: seg
366-379 seg

LPLAINAISSLLAA

superfamily: SSF52047
521-845 RNI-like,LRR

YKVRRLSLFANKDPSCIAQLDLSHARSLGASGHLGQLISSVKSNALRVLDVQDCSELGNHHVKDIGRNPLLRYLNISGTDVTELPIQIGDMGFLETLDASFTELVEMPGSITRLRQLQRLFVSDETKLPDEIGNMKRLQELGDINAFKQSVNFLNELGKLTGLRKLGIIWDTNDILKSGKGSSKEKRLVSSLSKLDAGRLSNLYVTFYLREKDGFIGHPFLPALNSIREVYLRRGRMCWMNKWLLSLANLEKLYISGGDEIEQDDLRTVGSIPTLVEFKLYSGCLGPIIISSGFEQLERLELKFSFSQLTFEVGAMPNLKKLDLH

FPrintScan: PR00364
IPR000767
561-577 DISEASERSIST
Disease resistance protein

VKSNALRVLDVQDCSEL

Gene3D: G3DSA:3.80.10.10
746-845 no description

SIREVYLRRGRMCWMNKWLLSLANLEKLYISGGDEIEQDDLRTVGSIPTLVEFKLYSGCLGPIIISSGFEQLERLELKFSFSQLTFEVGAMPNLKKLDLH


Diseases

Disease Pathogen Avirulence gene
Wheat leaf rust Puccinia triticina

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox