PRGDB00061440 (Pl8)

From PRG Wiki
Jump to: navigation, search
Pl8
Gene Type Reference_R-Genes,_manually_curated
GenBank 47777762 (AY490793)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Helianthus annuus

Comment?

Helianthus annuus clone Ha-NTIR11g CC-NBS-LRR gene, complete cds.

DNA Sequence

ATGGCTGAAACCGCTGTTACTGCCCTCTTCAAAGTCATTTTCCAGAAGCTAGCCGATGAAGCCTCCAGCAAATACGATCTCTCTCAGCGAATCCAATCCGACCTGAAGAATCTGGGAAAGAAACTGTCCCAGATCCAGCCTCTACTCAATGATGCTTCTCAAAAGGAGATAAAAGAAGAAGCTGTTAAACGGTGGCTGAACGATCTCCAACATTTGGCTTACGATATCGAAGACGTACTCGACGATGTGGCTACTGAAGCTATGCATCAAGGCCTGACCCAGGAGCCAGAATCAGTCATCGGCAAGATAAGAAATTTCATCCTAACTTGTTGCACGAATTTCTCTTTACGTCGTAGATTGCATAAGAAGTTAGAAGATATTACCACCGAGTTAGAACGTCTATATAAAGAAAAATCTGAGCTAGGTTTGATTGTGAAAGGTGCAAACCCAATATATGCTAGTAGACGAGACGAAACTTCTTTGCTAGAATCTGATGTTGTTGGGCGAGAAGGTGAGAAAAAGAGATTGCTCAATCAGCTGTTTGTAGGTGAATCATCTAAGGAAAACTTTATCATCGTACCCATCGTTGGTATGGGTGGGGTAGGGAAAACCACTCTTGCGAGAATGTTGTACAACGATACGCGAGTGAAGGTTCACTTTGAACTCATGGCATGGGTTTGCGTATCCGATGAGTTTGATATATTTAAAATAAGTCAAACCACCTATCAATCTGTGGCTAAAGAAAGCAAACAATTTACAGATACAAATCAGCTTCAAATTGCTCTTAAAGAGAAACTTGAGGGCAAACGATTTCTAGTAGTGCTCGATGATGTGTGGAATGAAAACTATGACGACTGGGAAAACCTAGTGCGTCCATTTCATTCTGGGGCTACTGGAAGTCGGGTGATCATGACAACTCGCCAACAGCAACTGCTCAAAAAGATGGGTTTTAATCATCTAGACCTTCTCGAGAGTTTGTCGCATGATGATGCTTTGTCTTTATTAGCTCGACATGCATTGGATGTAGATAACTTTGACTCGCATGAAACACTTAAACCACTAGGTGAAGGTATTGTCGAAAAGTGTGGTTGTTTGCCTTTGGCTTTAAAGGCAATTGGAAGGTTAATGAGAGCAAAAACCGAAGAAGAAGAATGGAGTGATGTGTTGAACAGTGAGATATGGGATTTAGAAAGTGCTGATGAAATTGTCCCAGCCCTTCGGCTAAGTTACCATGATCTTTCTGCCGATTTGAAGCGATTGTTTGCTTATTGCTCTTTGTTTCCTAAGGACTTTTTGTTTGAAAAAGAAGAGTTGGTATTATTATGGGTGGCTGAAGGGTATCTGAATGAGTCACTTGCAAACAAGTCACCAGAATGCTTGGCCCGTGAATATTTTGAGAAATTGCTATCGAGGTCATTTTTTCAACCTGCACCTAGTGGTGAACCCTTTTTTGTGATGCATGATCTCATCAACGACCTGGCCACATTTGTTGCTGGAGAATATTTTTTAAGGTTTGATAATCAGATGGCGATGAAAGAGGGAGCTTTAGCCAAGTACCGACATATGTCATTTATTCGTGAGGAGTATGTAGCTCTCCAGAAGTTCGGGGCATTTGAAAAGGCCAGAAGTTTGAGAACATTGTTAGCGGTATATGTTGGGGTAGATCAAGGCTGGAACAAGTTTTACTTATCCGGCAAGATTTTGGTTGACTTGCTTCCTCAGCTACCACTGTTAGGGGTTCTTTCTTTGAGGCGTTTTAATATAAGTGAGGTACCAAATTCCATTGGTACTTTGAAGCCCCTGAGGTATCTTAATCTATCTCATACAAATATAAACGAGTTGCCTGAGAATGTTGGCAATCTTTATAATTTACAGACATTGATAGTTTTTGGATGTCAAAGGCTGACCAATTTGCCTAAAAGCTTCTTTAAACTCAAAAGGCTGAGGCATTTTGACGTCAGAAATACTCCACGTTTGGAGAAGTTGCCTTTGGGAATTGGTGAGTTGAAAAGCCTGCAGACTCTCCCTAGGATCATCATCGGAGGAAACAATGGCTTTGCAATAACCGAGCTTAAGGGATTAAAGGATCTGCAGGGGGAAATTTCCATCGAGGGGCTGAACAAAGTGCAGAGCTCAATGCATGCACGAGAGGCGAACTTATCTTTCAAAGGGATTAACAAGTTAGAGTTGAAATGGGATGATGGGTCTGCAAGTGAAACACTTGAGAAGGAAGTTCTCAATGAGCTAAAGCCCCGCAGTGATAAGTTGAAAATGGTTGAGGTTGAGTGTTACCAGGGAATGGAGTTTCCAAACTGGGTTGGTGATCCGTCTTTTAATAGATTGGTTCATGTGTCGCTACGCGCTTGTAGAAAATGTACATCTCTACCGCCACTTGGGAGACTACCTTCACTTGAAATTCTAAGGTTTGAAGATATGTCGAGTTGGGAGGTATGGTCAACCATTAGGGAGGCAATGTTTCCATGCCTTCGAGAGCTTCAAATAAAAAATTGTCCCAATTTGATTGATGTCTCAGTTGAAGCATTACCTTCACTAAGAGTTTTAAGAATATATAAATGTTGTGAAAGTGTGCTGAGAAGTCTGGTTCTAGCAGCTTCATCAACCACAGAGATAGAAATCAGATCTATTTTAGGGCTTACGGATGAGGTGTGGAGAGGTGTTATAGAGAATTTGGGGGCAGTAGAAGAGCTAAGCATACAGGATTGTGATGAAATAAGATACCTGTGGGAATCAGAAGAAGAGGCAAGTAAAGTTCTTGTAAATTTAAAGGAATTGAAGGTAAGGGATTGTAAAAAATTGGTGAGTTTAGGAGAGAAAGAGGAGGATGAGGATAACATTGGGAGCAACCTCCTATCATCTCTTAGGAAGTTGGAGATACAGTCATGTGAAAGTATGGAGCGTTTGTGTTGTCCAAATAACATTGAAAGTTTAAATATCTATCAGTGTAGTTCAGTTAGACATGTGTCCTTACCAAGAGCAACAACAACAGGTGGAGGAGGGCAGAATCTCAAGTCACTTACTATAGACAGCTGTGAAAATCTAAAATCAATAAATCAATTGAGTAACTCCACTCACCTCAACTCTTTGTCAATATGGGGTTGTCAAAACATGGAGTTATTCTCTGGTCTTCATCAGCTATCAAATCTCACCTGGTTGACAATAGATGGTTGTGAAAGCATAGAGTCATTTCCTAACCTCCATCTACCAAATCTCACGCATCTGTTTATAGGTAGTTGCAAAAACATGAAGGCATTTGCTGACCTGCAGCTACCAAATCTAATCAGGTGGAGATTATGGAATTGTGAAAATCTGGAGTCATTTCCTGACCTTCAGCTATCCAATCTCACCATGTTAAAAGATATGTACATCAGAGAGTGTCCAATGATTGATGCTTCCTTTCCTCGTGGGCTTTGGCCTCCCAATTTGTGTTCCCTTGAAGTAGGGGGGTTGAAAAAGCCCATCTCAGAATGGGGCTATCAAAATTTCCCAGCTTCCCTTGTTTACCTATCGCTATATAAAGAACCTGATGTGAGGAATTTTAGTCAATTGTCCCACCTTTTCCCTTCTTCTCTTACAACTCTGGAGATAAACAAATTAGATAATCTGGAATCAGTTTCAATGGGACTCCAACACCTCACATCCCTTCAACATCTCAGTATTATCTATTGCCCAAAGGTGAACGATCTACCAGAGACGCTGCTGCCTTCACTTTTGAGTTTGAGAATCAGAGGATGCCCAAAATTGAAAGAAAGGTGTGAAGGAAGAGGCTCCCACTACTGGCCCCGAATCTCTCATATTCCCTGCATTGAAATTGAAGACTAA


Protein sequences

Name Description Sequence
CC-NBS-LRR CC-NBS-LRR [Helianthus annuus].

MAETAVTALFKVIFQKLADEASSKYDLSQRIQSDLKNLGKKLSQIQPLLNDASQKEIKEEAVKRWLNDLQHLAYDIEDVLDDVATEAMHQGLTQEPESVIGKIRNFILTCCTNFSLRRRLHKKLEDITTELERLYKEKSELGLIVKGANPIYASRRDETSLLESDVVGREGEKKRLLNQLFVGESSKENFIIVPIVGMGGVGKTTLARMLYNDTRVKVHFELMAWVCVSDEFDIFKISQTTYQSVAKESKQFTDTNQLQIALKEKLEGKRFLVVLDDVWNENYDDWENLVRPFHSGATGSRVIMTTRQQQLLKKMGFNHLDLLESLSHDDALSLLARHALDVDNFDSHETLKPLGEGIVEKCGCLPLALKAIGRLMRAKTEEEEWSDVLNSEIWDLESADEIVPALRLSYHDLSADLKRLFAYCSLFPKDFLFEKEELVLLWVAEGYLNESLANKSPECLAREYFEKLLSRSFFQPAPSGEPFFVMHDLINDLATFVAGEYFLRFDNQMAMKEGALAKYRHMSFIREEYVALQKFGAFEKARSLRTLLAVYVGVDQGWNKFYLSGKILVDLLPQLPLLGVLSLRRFNISEVPNSIGTLKPLRYLNLSHTNINELPENVGNLYNLQTLIVFGCQRLTNLPKSFFKLKRLRHFDVRNTPRLEKLPLGIGELKSLQTLPRIIIGGNNGFAITELKGLKDLQGEISIEGLNKVQSSMHAREANLSFKGINKLELKWDDGSASETLEKEVLNELKPRSDKLKMVEVECYQGMEFPNWVGDPSFNRLVHVSLRACRKCTSLPPLGRLPSLEILRFEDMSSWEVWSTIREAMFPCLRELQIKNCPNLIDVSVEALPSLRVLRIYKCCESVLRSLVLAASSTTEIEIRSILGLTDEVWRGVIENLGAVEELSIQDCDEIRYLWESEEEASKVLVNLKELKVRDCKKLVSLGEKEEDEDNIGSNLLSSLRKLEIQSCESMERLCCPNNIESLNIYQCSSVRHVSLPRATTTGGGGQNLKSLTIDSCENLKSINQLSNSTHLNSLSIWGCQNMELFSGLHQLSNLTWLTIDGCESIESFPNLHLPNLTHLFIGSCKNMKAFADLQLPNLIRWRLWNCENLESFPDLQLSNLTMLKDMYIRECPMIDASFPRGLWPPNLCSLEVGGLKKPISEWGYQNFPASLVYLSLYKEPDVRNFSQLSHLFPSSLTTLEINKLDNLESVSMGLQHLTSLQHLSIIYCPKVNDLPETLLPSLLSLRIRGCPKLKERCEGRGSHYWPRISHIPCIEIED

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
6-1115 PTHR23155:SF121,SUBFAMILY NOT NAMED

VTALFKVIFQKLADEASSKYDLSQRIQSDLKNLGKKLSQIQPLLNDASQKEIKEEAVKRWLNDLQHLAYDIEDVLDDVATEAMHQGLTQEPESVIGKIRNFILTCCTNFSLRRRLHKKLEDITTELERLYKEKSELGLIVKGANPIYASRRDETSLLESDVVGREGEKKRLLNQLFVGESSKENFIIVPIVGMGGVGKTTLARMLYNDTRVKVHFELMAWVCVSDEFDIFKISQTTYQSVAKESKQFTDTNQLQIALKEKLEGKRFLVVLDDVWNENYDDWENLVRPFHSGATGSRVIMTTRQQQLLKKMGFNHLDLLESLSHDDALSLLARHALDVDNFDSHETLKPLGEGIVEKCGCLPLALKAIGRLMRAKTEEEEWSDVLNSEIWDLESADEIVPALRLSYHDLSADLKRLFAYCSLFPKDFLFEKEELVLLWVAEGYLNESLANKSPECLAREYFEKLLSRSFFQPAPSGEPFFVMHDLINDLATFVAGEYFLRFDNQMAMKEGALAKYRHMSFIREEYVALQKFGAFEKARSLRTLLAVYVGVDQGWNKFYLSGKILVDLLPQLPLLGVLSLRRFNISEVPNSIGTLKPLRYLNLSHTNINELPENVGNLYNLQTLIVFGCQRLTNLPKSFFKLKRLRHFDVRNTPRLEKLPLGIGELKSLQTLPRIIIGGNNGFAITELKGLKDLQGEISIEGLNKVQSSMHAREANLSFKGINKLELKWDDGSASETLEKEVLNELKPRSDKLKMVEVECYQGMEFPNWVGDPSFNRLVHVSLRACRKCTSLPPLGRLPSLEILRFEDMSSWEVWSTIREAMFPCLRELQIKNCPNLIDVSVEALPSLRVLRIYKCCESVLRSLVLAASSTTEIEIRSILGLTDEVWRGVIENLGAVEELSIQDCDEIRYLWESEEEASKVLVNLKELKVRDCKKLVSLGEKEEDEDNIGSNLLSSLRKLEIQSCESMERLCCPNNIESLNIYQCSSVRHVSLPRATTTGGGGQNLKSLTIDSCENLKSINQLSNSTHLNSLSIWGCQNMELFSGLHQLSNLTWLTIDGCESIESFPNLHLPNLTHLFIGSCKNMKAFADLQLPNLIRWRLWNCENLESFPD

HMMPanther: PTHR23155
6-1115 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTALFKVIFQKLADEASSKYDLSQRIQSDLKNLGKKLSQIQPLLNDASQKEIKEEAVKRWLNDLQHLAYDIEDVLDDVATEAMHQGLTQEPESVIGKIRNFILTCCTNFSLRRRLHKKLEDITTELERLYKEKSELGLIVKGANPIYASRRDETSLLESDVVGREGEKKRLLNQLFVGESSKENFIIVPIVGMGGVGKTTLARMLYNDTRVKVHFELMAWVCVSDEFDIFKISQTTYQSVAKESKQFTDTNQLQIALKEKLEGKRFLVVLDDVWNENYDDWENLVRPFHSGATGSRVIMTTRQQQLLKKMGFNHLDLLESLSHDDALSLLARHALDVDNFDSHETLKPLGEGIVEKCGCLPLALKAIGRLMRAKTEEEEWSDVLNSEIWDLESADEIVPALRLSYHDLSADLKRLFAYCSLFPKDFLFEKEELVLLWVAEGYLNESLANKSPECLAREYFEKLLSRSFFQPAPSGEPFFVMHDLINDLATFVAGEYFLRFDNQMAMKEGALAKYRHMSFIREEYVALQKFGAFEKARSLRTLLAVYVGVDQGWNKFYLSGKILVDLLPQLPLLGVLSLRRFNISEVPNSIGTLKPLRYLNLSHTNINELPENVGNLYNLQTLIVFGCQRLTNLPKSFFKLKRLRHFDVRNTPRLEKLPLGIGELKSLQTLPRIIIGGNNGFAITELKGLKDLQGEISIEGLNKVQSSMHAREANLSFKGINKLELKWDDGSASETLEKEVLNELKPRSDKLKMVEVECYQGMEFPNWVGDPSFNRLVHVSLRACRKCTSLPPLGRLPSLEILRFEDMSSWEVWSTIREAMFPCLRELQIKNCPNLIDVSVEALPSLRVLRIYKCCESVLRSLVLAASSTTEIEIRSILGLTDEVWRGVIENLGAVEELSIQDCDEIRYLWESEEEASKVLVNLKELKVRDCKKLVSLGEKEEDEDNIGSNLLSSLRKLEIQSCESMERLCCPNNIESLNIYQCSSVRHVSLPRATTTGGGGQNLKSLTIDSCENLKSINQLSNSTHLNSLSIWGCQNMELFSGLHQLSNLTWLTIDGCESIESFPNLHLPNLTHLFIGSCKNMKAFADLQLPNLIRWRLWNCENLESFPD

superfamily: SSF52540
149-398 SSF52540

NPIYASRRDETSLLESDVVGREGEKKRLLNQLFVGESSKENFIIVPIVGMGGVGKTTLARMLYNDTRVKVHFELMAWVCVSDEFDIFKISQTTYQSVAKESKQFTDTNQLQIALKEKLEGKRFLVVLDDVWNENYDDWENLVRPFHSGATGSRVIMTTRQQQLLKKMGFNHLDLLESLSHDDALSLLARHALDVDNFDSHETLKPLGEGIVEKCGCLPLALKAIGRLMRAKTEEEEWSDVLNSEIWDLES

Gene3D: G3DSA:3.40.50.300
164-315 G3DSA:3.40.50.300

SDVVGREGEKKRLLNQLFVGESSKENFIIVPIVGMGGVGKTTLARMLYNDTRVKVHFELMAWVCVSDEFDIFKISQTTYQSVAKESKQFTDTNQLQIALKEKLEGKRFLVVLDDVWNENYDDWENLVRPFHSGATGSRVIMTTRQQQLLKKM

HMMPfam: PF00931
IPR002182
170-449 NB-ARC,NBS
NB-ARC

EGEKKRLLNQLFVGESSKENFIIVPIVGMGGVGKTTLARMLYNDTRVKVHFELMAWVCVSDEFDIFKISQTTYQSVAKESKQFTDTNQLQIALKEKLEGKRFLVVLDDVWNENYDDWENLVRPFHSGATGSRVIMTTRQQQLLKKMGFNHLDLLESLSHDDALSLLARHALDVDNFDSHETLKPLGEGIVEKCGCLPLALKAIGRLMRAKTEEEEWSDVLNSEIWDLESADEIVPALRLSYHDLSADLKRLFAYCSLFPKDFLFEKEELVLLWVAEGYLN

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

IVPIVGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
265-279 DISEASERSIST
Disease resistance protein

KLEGKRFLVVLDDVW

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

CGCLPLALKAIGRLM

superfamily: SSF52058
485-937 SSF52058,LRR

VMHDLINDLATFVAGEYFLRFDNQMAMKEGALAKYRHMSFIREEYVALQKFGAFEKARSLRTLLAVYVGVDQGWNKFYLSGKILVDLLPQLPLLGVLSLRRFNISEVPNSIGTLKPLRYLNLSHTNINELPENVGNLYNLQTLIVFGCQRLTNLPKSFFKLKRLRHFDVRNTPRLEKLPLGIGELKSLQTLPRIIIGGNNGFAITELKGLKDLQGEISIEGLNKVQSSMHAREANLSFKGINKLELKWDDGSASETLEKEVLNELKPRSDKLKMVEVECYQGMEFPNWVGDPSFNRLVHVSLRACRKCTSLPPLGRLPSLEILRFEDMSSWEVWSTIREAMFPCLRELQIKNCPNLIDVSVEALPSLRVLRIYKCCESVLRSLVLAASSTTEIEIRSILGLTDEVWRGVIENLGAVEELSIQDCDEIRYLWESEEEASKVLVNLKELKVRDCK

Gene3D: G3DSA:3.80.10.10
569-675 G3DSA:3.80.10.10

VDLLPQLPLLGVLSLRRFNISEVPNSIGTLKPLRYLNLSHTNINELPENVGNLYNLQTLIVFGCQRLTNLPKSFFKLKRLRHFDVRNTPRLEKLPLGIGELKSLQTL

Gene3D: G3DSA:3.80.10.10
777-962 G3DSA:3.80.10.10

SFNRLVHVSLRACRKCTSLPPLGRLPSLEILRFEDMSSWEVWSTIREAMFPCLRELQIKNCPNLIDVSVEALPSLRVLRIYKCCESVLRSLVLAASSTTEIEIRSILGLTDEVWRGVIENLGAVEELSIQDCDEIRYLWESEEEASKVLVNLKELKVRDCKKLVSLGEKEEDEDNIGSNLLSSLRK

FPrintScan: PR00364
IPR000767
955-971 DISEASERSIST
Disease resistance protein

NLLSSLRKLEIQSCESM

Gene3D: G3DSA:3.80.10.10
963-1141 G3DSA:3.80.10.10

LEIQSCESMERLCCPNNIESLNIYQCSSVRHVSLPRATTTGGGGQNLKSLTIDSCENLKSINQLSNSTHLNSLSIWGCQNMELFSGLHQLSNLTWLTIDGCESIESFPNLHLPNLTHLFIGSCKNMKAFADLQLPNLIRWRLWNCENLESFPDLQLSNLTMLKDMYIRECPMIDASFPR

superfamily: SSF52058
1007-1271 SSF52058,LRR

QNLKSLTIDSCENLKSINQLSNSTHLNSLSIWGCQNMELFSGLHQLSNLTWLTIDGCESIESFPNLHLPNLTHLFIGSCKNMKAFADLQLPNLIRWRLWNCENLESFPDLQLSNLTMLKDMYIRECPMIDASFPRGLWPPNLCSLEVGGLKKPISEWGYQNFPASLVYLSLYKEPDVRNFSQLSHLFPSSLTTLEINKLDNLESVSMGLQHLTSLQHLSIIYCPKVNDLPETLLPSLLSLRIRGCPKLKERCEGRGSHYWPRISH

Gene3D: G3DSA:3.80.10.10
1182-1255 G3DSA:3.80.10.10

DVRNFSQLSHLFPSSLTTLEINKLDNLESVSMGLQHLTSLQHLSIIYCPKVNDLPETLLPSLLSLRIRGCPKLK


Diseases

Disease Pathogen Avirulence gene
Downy mildew sunflower Plasmopara halstedii

List of References

O Radwan, M F Bouzidi, P Nicolas, S Mouzeyar
Development of PCR markers for the Pl5/Pl8 locus for resistance to Plasmopara halstedii in sunflower, Helianthus annuus L. from complete CC-NBS-LRR sequences.
Theor. Appl. Genet.: 2004, 109(1);176-85
PubMed:15007505 WorldCat.org DOI (P p)

O Radwan, S Mouzeyar, P Nicolas, M F Bouzidi
Induction of a sunflower CC-NBS-LRR resistance gene analogue during incompatible interaction with Plasmopara halstedii.
J. Exp. Bot.: 2005, 56(412);567-75
PubMed:15545294 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox