PRGDB00061441 (SSI4)

From PRG Wiki
Jump to: navigation, search
SSI4
Gene Type Reference_R-Genes,_manually_curated
GenBank 27466163 (AY179750)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Chromosome 5
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana TIR-NBS-LRR (SSI4) gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTGTTTGTCTTGCATCAAGAGATACCAAGTCTTTTCGAGCTTCCACGGTCCAGATGTCCGTAAAGGGTTTCTCAGTCATTTACACAGTCTCTTTGCAAGCAAAGGTATCACGACTTTCAATGATCAGAAGATCGAGAGAGGCCAGACGATCGGACCTGAGCTCATACAAGGGATTAGAGAAGCTAGAGTCTCGATCGTTGTGCTCTCGAAGAAGTACGCTTCTTCCAGCTGGTGTTTAGATGAACTTGTGGAAATCTTGAACTGCAAAGAAGCTTTGGTGCAGATTGTGATGACGGTTTTTTACGAAGTTGATCCGTCAGATGTTAAGAAACAGAGTGGAGAGTTCGGGAAAGTTTTTGAGAAGACTTGTCAAGGGAAAAATGAGGAAGTGGAGCAGAGATGGAGAAATGCTTTGGCAGATGTCGCTATCATTGCTGGGGAACACTCTCTTAATTGGGATAATGAAGCAGATATGATCCAAAAGATTGTTACAGATGTTTCAGACAAACTGAATCTCACACCGTCGAGGGATTTTGAGGGGATGGTAGGGATGGAAGCTCACTTGACAGAATTGAAGTCTTTGTTAAGCCTGGAAAGTGATGAAGTCAAGATGATTGGAATTTGGGGTCCAGCGGGAATTGGTAAGACTACCATTGCTAGAGCTTTATTCGACAGACTCTCTAGTATTTTTCCGCTTATATGTTTTATGGAGAACCTCAAGGGAAGTCTTACGGGTGTTGCTGACCATGATTCCAAGTTGAGGTTGCAAAACCAACTTCTGTCTAAGATTTTGAACCAAGAGAATATGAAGATACATCATTTAGGCGCAATACGAGAAAGGCTACACGATCAAAGAGTGCTCATCATTCTTGACGATGTAGATGATCTTGAGCAATTAGAGGTATTGGCTGAAGATCCTTCTTGGTTTGGTTCTGGCAGTCGGATCATCGTTACCACAGAAGATAAGAAGATTTTGAAAGCACATAGGATTAAGGATATCTACCATGTGAATTTTCCATCGAAGAAAGAAGCTCTTGAGATCTTATGTCTCTCTACATTCAAACAAAGCTCTATACCAGATGGTTTTGAAGAGCTTGCCAATAAAGTAGCTGAGCTTTGCGGCAATCTTCCATTAGGCCTTCGTGTCGTGGGTTCATCTTTGCGTGGGGAGAGCAAGCAAGAGTGGGAACTTCAATTGTCTAGTATCGAAGCTAGTCTTGATGGAAAAATTGAGACCACATTAAAAGTGGGATATGAAAGATTGTCGAAGAAAAATCAATCTCTATTCCTTCACATTGCATGCTTCTTCAACAATCAAGAGGTTGATTACGTGACAGCCTTGCTAGCTGACAGGAATTTGGATGTTGGAAATGGTTTCAATATCCTAGCCGATAGATCTCTCGTGCGTATATCTACCTATGGTGATATAGTGATGCACCATCTACTACAACAATTGGGTAGACAGATAGTTCATGAACAGTCTGACGAGCCCGGGAAACGTGAATTTATAATTGAGCCAGAAGAGATTCGTGATGTACTGACAGATGAAACAGGTACTGGATCTGTCAAAGGTATATCATTTGATGCATCCAATAGCGAAGAGGTTTCGGTAGGTAAGGGGGCTTTTGAAGGAATGCCTAATCTCCAATTCCTAAGAATCTATAGAGAATATTTCAATAGTGAAGGTACTTTGCAAATACCAGAAGATATGAAGTATTTACCTCCTGTTAGGTTACTACATTGGGAAAATTACCCAAGAAAAAGTCTTCCTCAGAGATTCCACCCGGAACATCTCGTCAAAATTTATATGCCACGCAGCAAGCTCAAGAAGCTCTGGGGAGGAATCCAGCCCCTTCCTAATATCAAGAGCATAGATCTGAGCTTTTCCATTAGATTGAAAGAAATCCCAAATCTTTCGAATGCTACTAATCTCGAGACATTAAACCTTACTCACTGCAAAACTTTGGTGGAACTTCCCTCCTCTATTTCGAATCTACACAAACTGAAAAAGCTTAAGATGTCAGGGTGCGAAAACCTACGAGTTATTCCCACCAACATCAACTTAGCATCTCTTGAGAGACTCGACATGAGTGGTTGCTCACGATTGAGAACTTTTCCAGATATCTCCAGCAACATCGACACACTCAATCTCGGAGATACAAAGATAGAAGATGTCCCTCCATCAGTTGGATGTTGGTCTCGTCTTATTCAGCTTAACATTAGCTGCGGACCCCTCACGAGATTGATGCATGTACCACCATGTATAACTATCCTAATTCTTAAAGGCAGTGATATAGAGAGGATTCCAGAAAGCATCATAGGTCTCACTCGTCTACATTGGCTGATTGTCGAAAGCTGCATAAAACTCAAGTCAATTCTGGGTCTCCCCTCCTCCCTCCAGGGCCTAGATGCAAATGATTGTGTATCACTCAAGAGAGTACGCTTCTCTTTCCATAACCCAATCCACATACTCAATTTCAACAACTGTTTGAAACTGGATGAAGAAGCAAAAAGAGGAATCATACAACGATCAGTGTCCGGGTACATATGCTTACCAGGTAAAAATATCCCTGAAGAGTTCACTCACAAAGCAACAGGGAGATCCATAACCATCCCTCTGGCACCTGGTACTCTCTCTGCTTCCTCAAGGTTTAAGGCTTCCATTCTCATTTTGCCAGTTGAGAGCTACGAAAATGAAGTTATACGTTGTAGTATAAGAACCAAAGGAGGTGTTGAAGTTCATTGCTGCGAGCTTCCATATCACTTTTTGCGTTTTCGGTCAGAACACCTGTATATATTTCATGGTGACTTGTTTCCCCAAGGAAACAAATACCATGAAGTGGATGTGACTATGAGAGAGATTACATTTGAGTTCAGCTACACTAAAATCGGTGACAAGATTATTGAGTGTGGTGTACAGATCATGACAGAGGGAGCTGAGGGTGACAGTAGCAGGGAATTGGACAGCTTTGAAACTGAGAGTAGCAGCAGCCAAGTGGGCAACTTTGAATTTGGAGGCAACAACAATCACCACACAGATGGAAATGGAGATGGAAACTATGAAGCAGAAGGTTCCAAGTTCTCTCAAGATGAAAACATCAAAACCAGCAAACGTACTGGTTTTATGAGTTGGCTTCGGAAGCTTGGTCAGTGA


Protein sequences

Name Description Sequence
TIR-NBS-LRR TIR-NBS-LRR [Arabidopsis thaliana].

MASSSCLSCIKRYQVFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAIIAGEHSLNWDNEADMIQKIVTDVSDKLNLTPSRDFEGMVGMEAHLTELKSLLSLESDEVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQSSIPDGFEELANKVAELCGNLPLGLRVVGSSLRGESKQEWELQLSSIEASLDGKIETTLKVGYERLSKKNQSLFLHIACFFNNQEVDYVTALLADRNLDVGNGFNILADRSLVRISTYGDIVMHHLLQQLGRQIVHEQSDEPGKREFIIEPEEIRDVLTDETGTGSVKGISFDASNSEEVSVGKGAFEGMPNLQFLRIYREYFNSEGTLQIPEDMKYLPPVRLLHWENYPRKSLPQRFHPEHLVKIYMPRSKLKKLWGGIQPLPNIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELPSSISNLHKLKKLKMSGCENLRVIPTNINLASLERLDMSGCSRLRTFPDISSNIDTLNLGDTKIEDVPPSVGCWSRLIQLNISCGPLTRLMHVPPCITILILKGSDIERIPESIIGLTRLHWLIVESCIKLKSILGLPSSLQGLDANDCVSLKRVRFSFHNPIHILNFNNCLKLDEEAKRGIIQRSVSGYICLPGKNIPEEFTHKATGRSITIPLAPGTLSASSRFKASILILPVESYENEVIRCSIRTKGGVEVHCCELPYHFLRFRSEHLYIFHGDLFPQGNKYHEVDVTMREITFEFSYTKIGDKIIECGVQIMTEGAEGDSSRELDSFETESSSSQVGNFEFGGNNNHHTDGNGDGNYEAEGSKFSQDENIKTSKRTGFMSWLRKLGQ

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSCLSCIKRYQVFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAIIAGE

Gene3D: G3DSA:3.40.50.10140
11-145 G3DSA:3.40.50.10140

KRYQVFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALAD

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KRYQVFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAII

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYQVFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAII

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFSSFHGPDVRKGFLSHLHSLFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALA

HMMPanther: PTHR11017:SF20
35-1008 PTHR11017:SF20,SUBFAMILY NOT NAMED

LFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAIIAGEHSLNWDNEADMIQKIVTDVSDKLNLTPSRDFEGMVGMEAHLTELKSLLSLESDEVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQSSIPDGFEELANKVAELCGNLPLGLRVVGSSLRGESKQEWELQLSSIEASLDGKIETTLKVGYERLSKKNQSLFLHIACFFNNQEVDYVTALLADRNLDVGNGFNILADRSLVRISTYGDIVMHHLLQQLGRQIVHEQSDEPGKREFIIEPEEIRDVLTDETGTGSVKGISFDASNSEEVSVGKGAFEGMPNLQFLRIYREYFNSEGTLQIPEDMKYLPPVRLLHWENYPRKSLPQRFHPEHLVKIYMPRSKLKKLWGGIQPLPNIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELPSSISNLHKLKKLKMSGCENLRVIPTNINLASLERLDMSGCSRLRTFPDISSNIDTLNLGDTKIEDVPPSVGCWSRLIQLNISCGPLTRLMHVPPCITILILKGSDIERIPESIIGLTRLHWLIVESCIKLKSILGLPSSLQGLDANDCVSLKRVRFSFHNPIHILNFNNCLKLDEEAKRGIIQRSVSGYICLPGKNIPEEFTHKATGRSITIPLAPGTLSASSRFKASILILPVESYENEVIRCSIRTKGGVEVHCCELPYHFLRFRSEHLYIFHGDLFPQGNKYHEVDVTMREITFEFSYTKIGDKIIECGVQIMTEGAEGDSSRELDSFETESSSSQVGNFE

HMMPanther: PTHR11017
35-1008 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LFASKGITTFNDQKIERGQTIGPELIQGIREARVSIVVLSKKYASSSWCLDELVEILNCKEALVQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQGKNEEVEQRWRNALADVAIIAGEHSLNWDNEADMIQKIVTDVSDKLNLTPSRDFEGMVGMEAHLTELKSLLSLESDEVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQSSIPDGFEELANKVAELCGNLPLGLRVVGSSLRGESKQEWELQLSSIEASLDGKIETTLKVGYERLSKKNQSLFLHIACFFNNQEVDYVTALLADRNLDVGNGFNILADRSLVRISTYGDIVMHHLLQQLGRQIVHEQSDEPGKREFIIEPEEIRDVLTDETGTGSVKGISFDASNSEEVSVGKGAFEGMPNLQFLRIYREYFNSEGTLQIPEDMKYLPPVRLLHWENYPRKSLPQRFHPEHLVKIYMPRSKLKKLWGGIQPLPNIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELPSSISNLHKLKKLKMSGCENLRVIPTNINLASLERLDMSGCSRLRTFPDISSNIDTLNLGDTKIEDVPPSVGCWSRLIQLNISCGPLTRLMHVPPCITILILKGSDIERIPESIIGLTRLHWLIVESCIKLKSILGLPSSLQGLDANDCVSLKRVRFSFHNPIHILNFNNCLKLDEEAKRGIIQRSVSGYICLPGKNIPEEFTHKATGRSITIPLAPGTLSASSRFKASILILPVESYENEVIRCSIRTKGGVEVHCCELPYHFLRFRSEHLYIFHGDLFPQGNKYHEVDVTMREITFEFSYTKIGDKIIECGVQIMTEGAEGDSSRELDSFETESSSSQVGNFE

superfamily: SSF52540
169-415 SSF52540

TDVSDKLNLTPSRDFEGMVGMEAHLTELKSLLSLESDEVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQSSIPDGFEELANKVAELCGNLPLGLRVVGSSLRGESKQEWELQLSSIEASLDGKI

HMMPfam: PF00931
IPR002182
190-447 NB-ARC,NBS
NB-ARC

EAHLTELKSLLSLESDEVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQSSIPDGFEELANKVAELCGNLPLGLRVVGSSLRGESKQEWELQLSSIEASLDGKIETTLKVGYERLSKKNQSLFLHIACFFNNQEVD

Gene3D: G3DSA:3.40.50.300
206-360 G3DSA:3.40.50.300

EVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFPSKKEALEILCLSTFKQ

HMMSmart: SM00382
IPR003593
206-344 AAA,NBS
AAA+ ATPase domain

EVKMIGIWGPAGIGKTTIARALFDRLSSIFPLICFMENLKGSLTGVADHDSKLRLQNQLLSKILNQENMKIHHLGAIRERLHDQRVLIILDDVDDLEQLEVLAEDPSWFGSGSRIIVTTEDKKILKAHRIKDIYHVNFP

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

MIGIWGPAGIGKTTIA

FPrintScan: PR00364
IPR000767
285-299 DISEASERSIST
Disease resistance protein

RLHDQRVLIILDDVD

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

CGNLPLGLRVVGSSL

superfamily: SSF46785
413-519 SSF46785

GKIETTLKVGYERLSKKNQSLFLHIACFFNNQEVDYVTALLADRNLDVGNGFNILADRSLVRISTYGDIVMHHLLQQLGRQIVHEQSDEPGKREFIIEPEEIRDVLT

superfamily: SSF52058
493-837 SSF52058,LRR

QIVHEQSDEPGKREFIIEPEEIRDVLTDETGTGSVKGISFDASNSEEVSVGKGAFEGMPNLQFLRIYREYFNSEGTLQIPEDMKYLPPVRLLHWENYPRKSLPQRFHPEHLVKIYMPRSKLKKLWGGIQPLPNIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELPSSISNLHKLKKLKMSGCENLRVIPTNINLASLERLDMSGCSRLRTFPDISSNIDTLNLGDTKIEDVPPSVGCWSRLIQLNISCGPLTRLMHVPPCITILILKGSDIERIPESIIGLTRLHWLIVESCIKLKSILGLPSSLQGLDANDCVSLKRVRFSFHNPIHILNFNNCLKL

Gene3D: G3DSA:3.80.10.10
531-821 G3DSA:3.80.10.10

SFDASNSEEVSVGKGAFEGMPNLQFLRIYREYFNSEGTLQIPEDMKYLPPVRLLHWENYPRKSLPQRFHPEHLVKIYMPRSKLKKLWGGIQPLPNIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELPSSISNLHKLKKLKMSGCENLRVIPTNINLASLERLDMSGCSRLRTFPDISSNIDTLNLGDTKIEDVPPSVGCWSRLIQLNISCGPLTRLMHVPPCITILILKGSDIERIPESIIGLTRLHWLIVESCIKLKSILGLPSSLQGLDANDCVSLKRVRFS

HMMPfam: PF07725
IPR011713
602-621 LRR_3
Leucine-rich repeat 3

HLVKIYMPRSKLKKLWGGIQ

HMMPfam: PF00560
IPR001611
648-670 LRR_1
Leucine-rich repeat

NLETLNLTHCKTLVELPSSISNL

FPrintScan: PR00364
IPR000767
691-707 DISEASERSIST
Disease resistance protein

INLASLERLDMSGCSRL

HMMPfam: PF00560
IPR001611
695-714 LRR_1
Leucine-rich repeat

SLERLDMSGCSRLRTFPDIS


Diseases

Disease Pathogen Avirulence gene
Bacterial Blight Pseudomonas syringae

List of References

Yumiko Shirano, Pradeep Kachroo, Jyoti Shah, Daniel F Klessig
A gain-of-function mutation in an Arabidopsis Toll Interleukin1 receptor-nucleotide binding site-leucine-rich repeat type R gene triggers defense responses and results in enhanced disease resistance.
Plant Cell: 2002, 14(12);3149-62
PubMed:12468733 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox