PRGDB00061444 (Pi2)

From PRG Wiki
Jump to: navigation, search
Pi2
Gene Type Reference_R-Genes,_manually_curated
GenBank 86361422 (DQ352453)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 6
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) cultivar C101A51 chromosome 6, clones BAC70, TAC40, TAC10, TAC30 sequence.

DNA Sequence

ATGGCGGAGACGGTGCTGAGCATGGCGAGGTCGCTGGTGGGCAGCGCCATCAGCAAGGCCGCCTCCGCTGCTGCCGACGAGACCAGCCTCCTGCTGGGCGTCGAGAAAGACATCTGGTATATCAAAGATGAGCTAAAAACGATGCAAGCATTCCTTAGAGCTGCTGAACTTATGAAAAAGAAAGATGAACTATTAAAGGTTTGGGCAGAGCAAATACGTGACCTGTCATATGACATTGAAGATTCCCTTGATGAATTTAAGGTCCATATTGAAAGCCAAACCCTATTTCGTCAGTTGGTGAAACTCAGAGAACGCCACCGAATTGCTATCCGTATCCACAACCTTAAATCAAGAGTTGAAGAAGTGAGTAGCAGGAACACACGCTACAGTTTAGTCAAGCCTATTTCCTCTGGCACAGAGATTGACATGGATTCCTATGCAGAAGACATTCGTAATCAGTCAGCTCGCAATGTGGATGAAGCTGAGCTTGTTGGGTTTTCTGACTCCAAGAAAAGGCTGCTTGAAATGATCGATACCAATGCTAATGATGGTCCGGCCAAGGTAATCTGTGTTGTTGGGATGGGTGGTTTAGGCAAGACAGCTCTTTCGAGGAAGATCTTTGAAAGCGAAGAAGACATTAGGAAGAACTTCCCTTGCAATGCTTGGATTACAGTGTCACAATCATTTCACAGGATTGAGCTACTTAAAGATATGATACGCCAACTTCTTGGCCCCAGTTCTCTGGATCAACTCTTGCAAGAATTGCAAGGGAAGGTGGTGGTGCAAGTACATCATCTTTCTGAGTACCTGATAGAAGAGCTCAAGGAGAAGAGGTACTTTGTTGTTCTAGATGATCTATGGATTTTACATGATTGGAATTGGATAAATGAAATTGCATTTCCTAAGAACAATAAGAAGGGCAGTCGAATAGTAATAACCACTCGGAATGTTGATCTTGCGGAGAAGTGTGCCACAGCCTCACTGGTGTACCACCTTGATTTCTTGCAGATGAACGATGCCATAACATTGCTACTGAGAAAAACAAATAAAAATCATGAAGACATGGAATCAAATAAAAATATGCAAAAGATGGTTGAACGAATTGTAAATAAATGTGGTCGTCTACCATTAGCAATACTTACAATAGGAGCTGTGCTTGCAACTAAACAGGTGTCAGAATGGGAGAAATTCTATGAACACCTTCCTTCAGAACTAGAAATAAACCCAAGCCTGGAAGCTTTGAGGAGAATGGTGACCCTAGGTTACAACCACCTACCATCCCATTTGAAACCATGCTTTTTGTATCTAAGTATCTTTCCTGAGGATTTTGAAATCAAAAGGAATCGTCTAGTAGGTAGATGGATAGCAGAAGGGTTTGTTAGACCAAAGGTTGGGATGACGACTAAGGATGTCGGAGAAAGTTACTTTAATGAGCTAATCAACCGAAGTATGATTCAACGATCAAGAGTGGGCATAGCAGGAAAAATTAAGACTTGTCGAATTCATGATATCATCCGTGATATCACAGTTTCAATCTCGAGACAGGAAAATTTTGTATTATTACCAATGGGAGATGGCTCTGATTTAGTTCAGGAAAACACTCGCCACATAGCATTCCATGGGAGTATGTCCTGCAAAACTGGATTGGATTGGAGCATTATTCGATCATTAGCTATTTTTGGTGACAGACCCAAGAGTCTAGCACATGCAGTTTGTCCAGATCAATTGAGGATGTTACGGGTCTTGGATCTTGAAGATGTGACATTCTTAATCACTCAAAAAGATTTCGACCGTATTGCATTGTTGTGCCACTTGAAATACTTGAGTATTGGATATTCGTCATCCATATATTCACTTCCCAGATCCATTGGTAAACTACAGGGCCTACAAACTTTGAACATGCCGAGCACATACATTGCAGCACTACCAAGTGAGATCAGTAAACTCCAATGTCTGCATACTCTTCGTTGTATAGGACAGTTTCATTATGACAACTTTAGTCTAAACCACCCAATGAAGTGCATAACTAACACAATATGCCTGCCTAAAGTATTCACACCTTTAGTTAGTCGCGATGATCGTGCAAAACAAATTGCTGAATTGCACATGGCCACCAAAAGTTGCTGGTCTGAATCAATCGGTGTGAAGGTACCCAAAGGAATAGGTAAGTTGCGAGACTTGCAGGTTCTAGAGTATGTAGATATCAGGCGGACCAGTAGTAGAGCAATCAAAGAGCTGGGGCAGTTAAGCAAGCTGAGGAAATTAGGTGTGACAACAAACGGGTCGACAAAGGAAAAATGTAAGATACTTTATGCAGCCATTGAGAAGCTCTCTTCCCTCCAATCTCTCCATGTGGATGCTGCAGGAATCTCAGATGGTGGAACACTTGAGTGCCTAGATTCTATTTCATCTCCTCCTCCCCTACTGAGGACACTCGTGTTGGATGGAATTCTTGAGGAGATGCCTAACTGGATTGAGCAGCTCACTCACCTGAAGAAGATCTACTTATTGAGGAGCAAACTAAAGGAAGGTAAAACCATGCTGATACTTGGGGCACTGCCCAACCTCATGGTCCTTCATCTTTATCGGAATGCTTACCTTGGGGAGAAGCTAGTATTCAAAACAGGAGCATTCCCAAATCTTAGAACACTTTGGATTTATGAATTGGATCAGCTAAGAGAGATCAGATTTGAGGACGGCAGCTCACCCCTGTTGGAAAAGATAGAAATAGGCGAGTGCAGGTTGGAATCTGGGATTACTGGTATCATTCACCTTCCAAAGCTCAAGGAGATTCCAATTAGATACGGAAGTAAAGTGGCTGGGCTTGGTCAGCTGGAGGGAGAAGTGAACGCACACCCAAATCGCCCCGTGCTGCTAATGTACAGTGACCGAAGGTATCACGACCTGGGGGCTGAAGCCGAAGGATCTTCTATAGAAGTGCAAACAGCAGATCCTGTTCCTGATGCCGAAGGATCAGTCACTGTAGCAGTGGAAGCAACGGATCCCCTTCCCGAGCAGGAGGGAGAGAGCTCGCAGTCGCAGGTGATCACGTTGACGACGAATGATAGCGAAGAGATAGGCACAGCTCAAGCTGGCTGA


Protein sequences

Name Description Sequence
NBS-LRR type R protein, Nbs4-Pi NBS-LRR type R protein, Nbs4-Pi [Oryza sativa Indica Group].

MAETVLSMARSLVGSAISKAASAAADETSLLLGVEKDIWYIKDELKTMQAFLRAAELMKKKDELLKVWAEQIRDLSYDIEDSLDEFKVHIESQTLFRQLVKLRERHRIAIRIHNLKSRVEEVSSRNTRYSLVKPISSGTEIDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDMESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEALRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDVGESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDLVQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDVTFLITQKDFDRIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSEISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHMATKSCWSESIGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNGSTKEKCKILYAAIEKLSSLQSLHVDAAGISDGGTLECLDSISSPPPLLRTLVLDGILEEMPNWIEQLTHLKKIYLLRSKLKEGKTMLILGALPNLMVLHLYRNAYLGEKLVFKTGAFPNLRTLWIYELDQLREIRFEDGSSPLLEKIEIGECRLESGITGIIHLPKLKEIPIRYGSKVAGLGQLEGEVNAHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGSVTVAVEATDPLPEQEGESSQSQVITLTTNDSEEIGTAQAG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF127
14-966 PTHR11017:SF127,UNCHARACTERIZED

GSAISKAASAAADETSLLLGVEKDIWYIKDELKTMQAFLRAAELMKKKDELLKVWAEQIRDLSYDIEDSLDEFKVHIESQTLFRQLVKLRERHRIAIRIHNLKSRVEEVSSRNTRYSLVKPISSGTEIDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDMESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEALRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDVGESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDLVQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDVTFLITQKDFDRIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSEISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHMATKSCWSESIGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNGSTKEKCKILYAAIEKLSSLQSLHVDAAGISDGGTLECLDSISSPPPLLRTLVLDGILEEMPNWIEQLTHLKKIYLLRSKLKEGKTMLILGALPNLMVLHLYRNAYLGEKLVFKTGAFPNLRTLWIYELDQLREIRFEDGSSPLLEKIEIGECRLESGITGIIHLPKLKEIPIRYGSKVAGLGQLEGEVNAHPNRPVLLMYSDRRY

HMMPanther: PTHR11017
14-966 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GSAISKAASAAADETSLLLGVEKDIWYIKDELKTMQAFLRAAELMKKKDELLKVWAEQIRDLSYDIEDSLDEFKVHIESQTLFRQLVKLRERHRIAIRIHNLKSRVEEVSSRNTRYSLVKPISSGTEIDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDMESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEALRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDVGESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDLVQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDVTFLITQKDFDRIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSEISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHMATKSCWSESIGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNGSTKEKCKILYAAIEKLSSLQSLHVDAAGISDGGTLECLDSISSPPPLLRTLVLDGILEEMPNWIEQLTHLKKIYLLRSKLKEGKTMLILGALPNLMVLHLYRNAYLGEKLVFKTGAFPNLRTLWIYELDQLREIRFEDGSSPLLEKIEIGECRLESGITGIIHLPKLKEIPIRYGSKVAGLGQLEGEVNAHPNRPVLLMYSDRRY

superfamily: SSF52540
151-405 SSF52540

RNQSARNVDEAELVGFSDSKKRLLEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDMESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSEL

Gene3D: G3DSA:3.40.50.300
169-322 G3DSA:3.40.50.300

SKKRLLEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEK

HMMPfam: PF00931
IPR002182
174-462 NB-ARC,NBS
NB-ARC

LEMIDTNANDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMIRQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINEIAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDMESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEALRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRP

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

VICVVGMGGLGKTALS

FPrintScan: PR00364
IPR000767
273-287 DISEASERSIST
Disease resistance protein

ELKEKRYFVVLDDLW

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

CGRLPLAILTIGAVL

superfamily: SSF52047
551-888 SSF52047,LRR

WSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDVTFLITQKDFDRIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSEISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHMATKSCWSESIGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNGSTKEKCKILYAAIEKLSSLQSLHVDAAGISDGGTLECLDSISSPPPLLRTLVLDGILEEMPNWIEQLTHLKKIYLLRSKLKEGKTMLILGALPNLMVLHLYRNAYLGEKLVFKTGAFPNLRTLWIYE

FPrintScan: PR00364
IPR000767
574-590 DISEASERSIST
Disease resistance protein

DQLRMLRVLDLEDVTFL

Gene3D: G3DSA:3.80.10.10
574-779 G3DSA:3.80.10.10

DQLRMLRVLDLEDVTFLITQKDFDRIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSEISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHMATKSCWSESIGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNGSTKEKCKILYAAIEKLSS

Gene3D: G3DSA:3.80.10.10
780-935 G3DSA:3.80.10.10

LQSLHVDAAGISDGGTLECLDSISSPPPLLRTLVLDGILEEMPNWIEQLTHLKKIYLLRSKLKEGKTMLILGALPNLMVLHLYRNAYLGEKLVFKTGAFPNLRTLWIYELDQLREIRFEDGSSPLLEKIEIGECRLESGITGIIHLPKLKEIPIRY


Diseases

Disease Pathogen Avirulence gene
Rice blast disease

List of References

Bo Zhou, Shaohong Qu, Guifu Liu, Maureen Dolan, Hajime Sakai, Guodong Lu, Maria Bellizzi, Guo-Liang Wang
The eight amino-acid differences within three leucine-rich repeats between Pi2 and Piz-t resistance proteins determine the resistance specificity to Magnaporthe grisea.
Mol. Plant Microbe Interact.: 2006, 19(11);1216-28
PubMed:17073304 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox