PRGDB00061448 (Xa26)

From PRG Wiki
Jump to: navigation, search
Xa26
Gene Type Reference_R-Genes,_manually_curated
GenBank 90018762 (DQ426646)
Gene Class RLK
Domain Type Ser-Thr Kinase, LRR
Chromosome 11
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) bacterial blight resistance protein XA26 (Xa26) gene, complete cds.

DNA Sequence

ATGGCTCTTGTTCGATTGCCAGTATGGATTTTCGTTGCGGCGTTGTTGATCGCTTCGTCCAGTACTGTGCCTTGTGCTTCCTCTCTAGGTCCGATCGCCAGCAAGAGTAACAGCAGCGACACCGACCTCGCTGCATTGCTGGCCTTCAAAGCCCAGCTCTCCGATCCTAACAACATCCTTGCCGGCAATTGGACCACCGGAACGCCGTTCTGCCGGTGGGTGGGTGTCTCGTGCAGCAGCCACCGCCGCCGCCGGCAGCGCGTCACCGCCCTGGAACTGCCAAACGTTCCTCTCCAAGGAGAGCTCAGCTCTCACCTTGGTAACATTTCTTTTCTCTTCATCCTCAACCTCACCAACACCGGCCTCACTGGCTCGGTGCCCAACAAAATAGGAAGGCTGCGTCGCCTCGAGCTCCTTGATCTCGGCCACAATGCCATGTCAGGTGGCATCCCTGCAGCCATAGGGAACCTCACGAGGCTTCAGCTACTTAATCTACAGTTTAACCAGCTATACGGTCCAATCCCAGCAGAGCTGCAGGGGTTGCACAGTCTTGGCAGCATGAATCTCCGTCACAATTACCTCACTGGATCGATTCCGGACGATCTGTTCAACAACACGCCTTTGCTAACTTATCTCAACGTTGGTAACAATAGCCTGTCAGGACTGATACCGGGTTGCATCGGTTCCTTGCCAATCCTCCAACACCTTAACTTTCAGGCCAATAACTTAACTGGGGCGGTGCCACCAGCCATCTTCAACATGTCTAAATTAAGTACCATTTCTCTTATATCGAATGGTTTAACTGGCCCTATCCCTGGTAATACAAGTTTCAGCCTCCCAGTTCTACGATGGTTCGCCATCAGTAAAAACAATTTCTTTGGTCAGATTCCACTGGGGCTCGCAGCGTGTCCATACCTCCAAGTTATTGCCATGCCTTATAATTTATTCGAGGGTGTTTTGCCACCATGGCTGGGCAGGTTGACCAATCTTGATGCCATCTCCTTGGGTGGGAATAACTTTGATGCTGGCCCCATCCCTACTGAACTTAGCAACCTCACCATGCTGACAGTCTTAGATTTGACGACGTGCAACCTAACAGGAAACATCCCTGCAGATATTGGGCACCTAGGCCAACTTTCATGGTTGCATCTTGCGATGAATCAACTAACAGGACCTATTCCTGCTTCTCTTGGCAACCTTTCATCGTTGGCAATCCTGCTACTGAAAGGAAACTTGCTGGATGGATCATTACCATCGACAGTTGATAGCATGAACTCACTAACGGCAGTTGATGTTACTGAAAACAATCTACACGGGGATCTCAACTTCCTTTCTACTGTTTCCAATTGTAGGAAGCTTTCTACCCTCCAAATGGACCTGAATTATATCACCGGAATCCTCCCAGACTATGTTGGGAACCTGTCGTCACAGCTGAAATGGTTCACGTTATCTAACAACAAGTTAACTGGCACGCTTCCAGCTACCATTTCAAATTTAACTGCTCTTGAGGTGATAGATCTTTCACATAACCAACTGCGCAATGCAATTCCAGAATCAATCATGACGATTGAGAATCTCCAATGGCTTGACCTAAGTGGAAATAGCTTGTCTGGCTTCATCCCATCGAATACTGCACTTCTAAGGAACATTGTAAAACTGTTCCTTGAAAGCAACGAAATTTCTGGCTCCATACCAAAGGACATGAGGAACCTCACTAATCTAGAGCACCTTCTATTGTCTGATAACAAATTAACGTCAACTATACCACCAAGCTTATTTCATCTTGATAAAATCGTCAGGCTAGATCTTTCTCGAAACTTCTTGAGTGGTGCACTGCCGGTTGATGTAGGGTATTTGAAGCAAATTACCATCATGGATCTCTCTGACAACCACTTTTCTGGTAGAATCCCATATTCGATAGGACAACTTCAGATGTTAACACACCTGAATCTATCAGCTAACGGATTCTATGATTCTGTTCCAGACTCTTTTGGTAATTTAACTGGCTTGCAAACTTTGGACATATCCCATAACAGTATTTCTGGTACCATCCCAAACTACTTGGCTAATTTTACGACCCTTGTTAGCTTGAACCTATCTTTCAACAAACTACATGGTCAAATACCGGAAGGAGGTGTCTTTGCAAACATCACTTTACAATACTTGGAAGGAAACTCAGGGCTATGTGGTGCTGCCCGTTTAGGATTCCCACCATGCCAAACCACCTCCCCCAACAGAAATAATGGTCACATGCTAAAATATTTGCTACCTACTATAATCATAGTAGTTGGAATTGTAGCTTGTTGCCTGTATGTAGTGATTAGAAAGAAAGCTAACCATCAAAATACTTCTGCTGGTAAGGCTGACCTTATCAGCCATCAATTGCTCTCCTATCATGAGCTTCTTCGTGCAACCGATGATTTCAGCGATGATAGCATGTTGGGCTTCGGAAGCTTTGGAAAAGTTTTTAGGGGACGATTGAGCAACGGTATGGTGGTTGCCATAAAAGTTATACACCAGCATCTGGAACATGCCATGAGAAGCTTTGACACCGAGTGTCGTGTGCTCCGAATGGCTCGACATCGCAACCTGATAAAGATTCTGAACACTTGTTCCAACCTGGACTTCAGAGCACTGGTACTTCAGTACATGCCCAAGGGTAGCTTAGAAGCACTCCTGCACTCAGAACAAGGGAAGCAATTAGGCTTTCTCGAGAGGTTGGATATTATGCTAGATGTGTCAATGGCAATGGAATACCTGCATCATGAGCACTATGAGGTGGTCTTACACTGCGATTTGAAGCCTAGCAACGTACTATTTGACGATGATATGACGGCACATGTGGCAGACTTTGGTATTGCAAGGTTGTTGTTAGGTGATGACAACTCCATGATCTCAGCTAGCATGCCAGGAACAGTTGGGTACATGGCACCAGAGTATGGGACTCTAGGAAAAGCATCACGGAAGAGTGATGTGTTCAGTTACGGCATCATGCTGCTTGAAGTGTTCACTGCGAAGAGACCCACAGATGCTATGTTTGTGGGAGAACTGAACATCAGGCAGTGGGTTCAACAGGCGTTTCCTGCAGAGCTTGTCCATGTGGTGGACTGCCAACTTCTACAGGATGGCTCTTCTTCTTCTTCAAGTAACATGCATGACTTCCTTGTGCCAGTGTTCGAGCTGGGCTTGCTCTGTTCGGCTGACTCCCCCGAGCAAAGGATGGCGATGAGCGATGTGGTCTTGACACTGAACAAGATTAGAAAGGACTATGTCAAATTGATGGCAACCACAGTGAGCGTTGTGCAGCAGTGA


Protein sequences

Name Description Sequence
bacterial blight resistance protein XA26 bacterial blight resistance protein XA26 [Oryza sativa Japonica Group].

MALVRLPVWIFVAALLIASSSTVPCASSLGPIASKSNSSDTDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCSSHRRRRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYLEGNSGLCGAARLGFPPCQTTSPNRNNGHMLKYLLPTIIIVVGIVACCLYVVIRKKANHQNTSAGKADLISHQLLSYHELLRATDDFSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTLNKIRKDYVKLMATTVSVVQQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-1092 FAMILY NOT NAMED,FAMILY NOT NAMED

MALVRLPVWIFVAALLIASSSTVPCASSLGPIASKSNSSDTDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCSSHRRRRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYLEGNSGLCGAARLGFPPCQTTSPNRNNGHMLKYLLPTIIIVVGIVACCLYVVIRKKANHQNTSAGKADLISHQLLSYHELLRATDDFSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTLNKIRKDYVK

HMMPanther: PTHR24420:SF474
1-1092 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MALVRLPVWIFVAALLIASSSTVPCASSLGPIASKSNSSDTDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCSSHRRRRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYLEGNSGLCGAARLGFPPCQTTSPNRNNGHMLKYLLPTIIIVVGIVACCLYVVIRKKANHQNTSAGKADLISHQLLSYHELLRATDDFSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTLNKIRKDYVK

superfamily: SSF52058
36-340 L domain-like,LRR

SNSSDTDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCSSHRRRRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNF

HMMPfam: PF08263
IPR013210
40-79 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DTDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCS

Gene3D: G3DSA:3.80.10.10
41-331 no description

TDLAALLAFKAQLSDPNNILAGNWTTGTPFCRWVGVSCSSHRRRRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLD

Seg: seg
132-141 seg

RLRRLELLDL

Seg: seg
156-170 seg

NLTRLQLLNLQFNQL

HMMSmart: SM00369
IPR003591
157-180 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTRLQLLNLQFNQLYGPIPAELQG

HMMSmart: SM00365
157-183 Leucine-rich repeat, SDS22-like subfamily

LTRLQLLNLQFNQLYGPIPAELQGLHS

ProfileScan: PS51450
IPR001611
159-182 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLQLLNLQFNQLYGPIPAELQGLH

HMMSmart: SM00369
IPR003591
181-205 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LHSLGSMNLRHNYLTGSIPDDLFNN

HMMPfam: PF13855
183-243 LRR_8,Leucine rich repeat

SLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNL

ProfileScan: PS51450
IPR001611
183-205 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLGSMNLRHNYLTGSIPDDLFNN

ProfileScan: PS51450
IPR001611
208-230 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLTYLNVGNNSLSGLIPGCIGSL

HMMSmart: SM00369
IPR003591
230-254 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPILQHLNFQANNLTGAVPPAIFNM

Gene3D: G3DSA:3.80.10.10
332-468 no description

AISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILP

HMMPfam: PF00560
IPR001611
355-376 LRR_1
Leucine-rich repeat

LTVLDLTTCNLTGNIPADIGHL

ProfileScan: PS51450
IPR001611
359-380 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLTTCNLTGNIPADIGHLGQLS

superfamily: SSF52047
368-722 RNI-like,LRR

NIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYL

HMMSmart: SM00369
IPR003591
376-400 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LGQLSWLHLAMNQLTGPIPASLGNL

Seg: seg
396-417 seg

SLGNLSSLAILLLKGNLLDGSL

HMMPfam: PF13855
476-536 LRR_8,Leucine rich repeat

SQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSL

Gene3D: G3DSA:3.80.10.10
477-730 no description

QLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYLEGNSGLCG

ProfileScan: PS51450
IPR001611
477-500 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKWFTLSNNKLTGTLPATISNLT

HMMSmart: SM00369
IPR003591
499-520 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTALEVIDLSHNQLRNAIPESI

HMMSmart: SM00365
499-528 Leucine-rich repeat, SDS22-like subfamily

LTALEVIDLSHNQLRNAIPESIMTIENLQW

ProfileScan: PS51450
IPR001611
501-522 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALEVIDLSHNQLRNAIPESIMT

HMMSmart: SM00369
IPR003591
523-547 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

IENLQWLDLSGNSLSGFIPSNTALL

ProfileScan: PS51450
IPR001611
525-547 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQWLDLSGNSLSGFIPSNTALL

ProfileScan: PS51450
IPR001611
549-571 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIVKLFLESNEISGSIPKDMRNL

HMMSmart: SM00369
IPR003591
571-595 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLEHLLLSDNKLTSTIPPSLFHL

HMMSmart: SM00365
571-592 Leucine-rich repeat, SDS22-like subfamily

LTNLEHLLLSDNKLTSTIPPSL

HMMPfam: PF12799
572-609 LRR_4,Leucine Rich repeats (2 copies)

TNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLS

ProfileScan: PS51450
IPR001611
573-595 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEHLLLSDNKLTSTIPPSLFHL

HMMSmart: SM00369
IPR003591
643-666 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQMLTHLNLSANGFYDSVPDSFGN

ProfileScan: PS51450
IPR001611
645-667 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLTHLNLSANGFYDSVPDSFGNL

HMMPfam: PF13855
646-704 LRR_8,Leucine rich repeat

LTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKL

HMMSmart: SM00369
IPR003591
667-690 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTGLQTLDISHNSISGTIPNYLAN

HMMSmart: SM00365
667-690 Leucine-rich repeat, SDS22-like subfamily

LTGLQTLDISHNSISGTIPNYLAN

ProfileScan: PS51450
IPR001611
669-691 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQTLDISHNSISGTIPNYLANF

HMMSmart: SM00369
IPR003591
691-716 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FTTLVSLNLSFNKLHGQIPEGGVFAN

ProfileScan: PS51450
IPR001611
693-715 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLVSLNLSFNKLHGQIPEGGVFA

Gene3D: G3DSA:3.30.200.20
763-869 no description

VGIVACCLYVVIRKKANHQNTSAGKADLISHQLLSYHELLRATDDFSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILN

superfamily: SSF56112
IPR011009
778-1083 Protein kinase-like (PK-like)
Protein kinase-like domain

ANHQNTSAGKADLISHQLLSYHELLRATDDFSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTL

HMMSmart: SM00219
IPR020635
808-1083 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTL

HMMSmart: SM00220
IPR002290
808-1055 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFL

ProfileScan: PS50011
IPR000719
808-1091 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDDSMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQDGSSSSSSNMHDFLVPVFELGLLCSADSPEQRMAMSDVVLTLNKIRKDYV

HMMPfam: PF07714
IPR001245
812-1012 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SMLGFGSFGKVFRGRLSNGMVVAIKVIHQHLEHAMRSFDTECRVLRMARHRNLIKILNTCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAM

PatternScan: PS00107
IPR017441
814-836 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGFGSFGKVFRGRLSNGMVVAIK

Gene3D: G3DSA:1.10.510.10
870-1019 no description

TCSNLDFRALVLQYMPKGSLEALLHSEQGKQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTVGYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNI

PatternScan: PS00108
IPR008271
928-940 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHCDLKPSNVLF

Seg: seg
1044-1049 seg

SSSSSS


Diseases

Disease Pathogen Avirulence gene
Bacterial Blight

List of References

Yi Xiang, Yinglong Cao, Caiguo Xu, Xianghua Li, Shiping Wang
Xa3, conferring resistance for rice bacterial blight and encoding a receptor kinase-like protein, is the same as Xa26.
Theor. Appl. Genet.: 2006, 113(7);1347-55
PubMed:16932879 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox