PRGDB00061450 (xa27)

From PRG Wiki
Jump to: navigation, search
xa27
Gene Type Reference_R-Genes,_manually_curated
GenBank 66735941 (AY986491)
Gene Class Other
Domain Type
Chromosome 6
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) xa27 (xa27) gene, xa27-IR24 allele, complete cds.

DNA Sequence

ATGGCGGATTGGGCGATGCACCACTACCTCCTACTAGCCAACCAGCAACGCCACCGAGCCCTCGCCGACGTCGCCGTCCGCCGCCGCCAGCTGCTCCTCGACTCCGGCCGCGTCTTCATGCTCCTCGGCGCCGTCATCCTCATGCACATGCTCACCACTACCGGCGGCGGAGCATCGTCCGGCTGCACCCGCGGCGCCGAACCTTGCGTCGCCCTCCTCCTGTGGCTGCTCGGCGCGGCGCTCGCCATGCTGTCGCTCGTCGCCGGCCGATTCCCCGTTCTCGCTGCCGCCATTGCTGAGGAGCTCGGTGATCACCTGCTTGGTGGTCTCTGGTCTCTCTAG


Protein sequences

Name Description Sequence
xa27 xa27 [Oryza sativa Indica Group].

MADWAMHHYLLLANQQRHRALADVAVRRRQLLLDSGRVFMLLGAVILMHMLTTTGGGASSGCTRGAEPCVALLLWLLGAALAMLSLVAGRFPVLAAAIAEELGDHLLGGLWSL



Diseases

Disease Pathogen Avirulence gene
Bacterial Blight Xanthomonas oryzae

List of References

Keyu Gu, Bing Yang, Dongsheng Tian, Lifang Wu, Dongjiang Wang, Chellamma Sreekala, Fan Yang, Zhaoqing Chu, Guo-Liang Wang, Frank F White, Zhongchao Yin
R gene expression induced by a type-III effector triggers disease resistance in rice.
Nature: 2005, 435(7045);1122-5
PubMed:15973413 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox