PRGDB00061450 (xa27)

From PRG Wiki
Jump to: navigation, search
xa27
Gene Type Reference_R-Genes,_manually_curated
GenBank 66735941 (AY986491)
Gene Class Other
Domain Type
Chromosome 6
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) xa27 (xa27) gene, xa27-IR24 allele, complete cds.

DNA Sequence

ATGGCGGATTGGGCGATGCACCACTACCTCCTACTAGCCAACCAGCAACGCCACCGAGCCCTCGCCGACGTCGCCGTCCGCCGCCGCCAGCTGCTCCTCGACTCCGGCCGCGTCTTCATGCTCCTCGGCGCCGTCATCCTCATGCACATGCTCACCACTACCGGCGGCGGAGCATCGTCCGGCTGCACCCGCGGCGCCGAACCTTGCGTCGCCCTCCTCCTGTGGCTGCTCGGCGCGGCGCTCGCCATGCTGTCGCTCGTCGCCGGCCGATTCCCCGTTCTCGCTGCCGCCATTGCTGAGGAGCTCGGTGATCACCTGCTTGGTGGTCTCTGGTCTCTCTAG


Protein sequences

Name Description Sequence
xa27 xa27 [Oryza sativa Indica Group].

MADWAMHHYLLLANQQRHRALADVAVRRRQLLLDSGRVFMLLGAVILMHMLTTTGGGASSGCTRGAEPCVALLLWLLGAALAMLSLVAGRFPVLAAAIAEELGDHLLGGLWSL



Diseases

Disease Pathogen Avirulence gene
Bacterial Blight Xanthomonas oryzae

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox