PRGDB00061452 (IVR)

From PRG Wiki
Jump to: navigation, search
IVR
Gene Type Reference_R-Genes,_manually_curated
GenBank 3355639 (AJ009684)
Gene Class Other
Domain Type
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum mRNA for inhibitor of virus replication (IVR)-like protein.

DNA Sequence

ATGAATCGACCTGAAGCTGCTGTGGTTGCCTTTAGAGGAGCTCAAGAGTTGAGACCTGATCTTCGTTCTTATCAAGGTTTAGTACGCTCTTATTTAGCAATTTCAAAGATCAAGGAGGCACTGCATGCTGCAAGGGAGGCAATGAAGGCCATGCCACAGTCAGCAAAAGCTCTAAAATTGGTGGGTGATGTACATGCTAGTAATACTAGTGGGAGGGAAAAGGCAAAGAAGTTCTATGAATCTTCACTAAGGCTGGAACCTGGTTATCTTGGAGCAGCGCTAGCCTTGGCAGAACTGCATGTCATTGAAGGTCGAACTGTAGATGCTGTTACTCTCCTTGAGCGGTATCTCAAGGATTGGGCTGATGACTCGTTGCATGTTAAGCTTGCCCAAGTATTTGCTGCAACAAATATGCCACAAGATGCCTTGTCACACTACCAGGCAGCACTGAGGATAAATCCCCAAAATGAAGCTGCAAAGAAAGGGTTGGGAGCGCCTGGAGAAGCAGCTCAAGGGAGTAGATCTGATGCTCCTGAAGAAGATGAAGAGAATGATGCTGAGGATGCTGATGCAGACCAGGAAGAGGCTGAGCTTTTATGA


Protein sequences

Name Description Sequence
IVR-like protein IVR-like protein [Nicotiana tabacum].

MNRPEAAVVAFRGAQELRPDLRSYQGLVRSYLAISKIKEALHAAREAMKAMPQSAKALKLVGDVHASNTSGREKAKKFYESSLRLEPGYLGAALALAELHVIEGRTVDAVTLLERYLKDWADDSLHVKLAQVFAATNMPQDALSHYQAALRINPQNEAAKKGLGAPGEAAQGSRSDAPEEDEENDAEDADADQEEAELL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR12558:SF8
1-197 PTHR12558:SF8,ANAPHASE PROMOTING COMPLEX SUBUNIT 7

MNRPEAAVVAFRGAQELRPDLRSYQGLVRSYLAISKIKEALHAAREAMKAMPQSAKALKLVGDVHASNTSGREKAKKFYESSLRLEPGYLGAALALAELHVIEGRTVDAVTLLERYLKDWADDSLHVKLAQVFAATNMPQDALSHYQAALRINPQNEAAKKGLGAPGEAAQGSRSDAPEEDEENDAEDADADQEEAE

HMMPanther: PTHR12558
1-197 PTHR12558,CELL DIVISION CYCLE 16

MNRPEAAVVAFRGAQELRPDLRSYQGLVRSYLAISKIKEALHAAREAMKAMPQSAKALKLVGDVHASNTSGREKAKKFYESSLRLEPGYLGAALALAELHVIEGRTVDAVTLLERYLKDWADDSLHVKLAQVFAATNMPQDALSHYQAALRINPQNEAAKKGLGAPGEAAQGSRSDAPEEDEENDAEDADADQEEAE

ProfileScan: PS50293
IPR013026
1-21 TPR_REGION
Tetratricopeptide repeat-containing domain

MNRPEAAVVAFRGAQELRPDL

superfamily: SSF48452
1-162 SSF48452

MNRPEAAVVAFRGAQELRPDLRSYQGLVRSYLAISKIKEALHAAREAMKAMPQSAKALKLVGDVHASNTSGREKAKKFYESSLRLEPGYLGAALALAELHVIEGRTVDAVTLLERYLKDWADDSLHVKLAQVFAATNMPQDALSHYQAALRINPQNEAAKKG

Gene3D: G3DSA:1.25.40.10
IPR011990
2-164 TPR-like_helical
Tetratricopeptide-like helical

NRPEAAVVAFRGAQELRPDLRSYQGLVRSYLAISKIKEALHAAREAMKAMPQSAKALKLVGDVHASNTSGREKAKKFYESSLRLEPGYLGAALALAELHVIEGRTVDAVTLLERYLKDWADDSLHVKLAQVFAATNMPQDALSHYQAALRINPQNEAAKKGLG

ProfileScan: PS50005
IPR019734
21-54 TPR
Tetratricopeptide repeat

LRSYQGLVRSYLAISKIKEALHAAREAMKAMPQS

ProfileScan: PS50293
IPR013026
21-156 TPR_REGION
Tetratricopeptide repeat-containing domain

LRSYQGLVRSYLAISKIKEALHAAREAMKAMPQSAKALKLVGDVHASNTSGREKAKKFYESSLRLEPGYLGAALALAELHVIEGRTVDAVTLLERYLKDWADDSLHVKLAQVFAATNMPQDALSHYQAALRINPQN

ProfileScan: PS50005
IPR019734
123-156 TPR
Tetratricopeptide repeat

DSLHVKLAQVFAATNMPQDALSHYQAALRINPQN

HMMPfam: PF07719
IPR013105
126-156 TPR_2
Tetratricopeptide TPR2

HVKLAQVFAATNMPQDALSHYQAALRINPQN


Diseases

Disease Pathogen Avirulence gene
Tobacco Mosaic Virus Tobacco mosaic virus




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox