PRGDB00061453 (Pikm1-TS)

From PRG Wiki
Jump to: navigation, search
Pikm1-TS
Gene Type Reference_R-Genes,_manually_curated
GenBank 207367329 (AB462324)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 11
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Pikm1-TS mRNA for NBS-LRR class disease resistance protein, complete cds.

DNA Sequence

ATGGAGGCGGCTGCCATGGCCGTAACCGCAGCCACGGGGGCCTTGGCGCCCGTGCTAGTGAAGCTGGCCGCTTTGCTGGACGACGGGGAGTGCAATCTTCTGGAGGGGAGCCGGAGCGACGCAGAGTTCATCAGATCCGAGCTGGAGGCCGTGCACTCTCTCCTCACCCCAAATATCTTGGGGAGGATGGGGGATGACGATGCGGCGTGCAAGGATGGCTTGATTGCGGAGGTCCGGGAGCTGTCCTACGACCTGGATGATGCCGTCGACGACTTCTTGGAGCTCAATTTCGAGCAGCGAAGAAGCGCAAGCCCTTTCGGTGAGCTCAAGGCAAGAGTTGAGGAGCGTGTCTCCAATCGCTTCTCTGACTGGAAGCTACCGGCGGCGAGCCTTCCGCCGTCGTCGGTACACCGTCGAGCTGGCTTGCCGCCACCAGATGCAGGGCTGGTGGGGATGCACAAACGTAAGGAAGAGCTCATCGAGTTGCTGGAACAAGGGAGCAGTGATGCTTCACGATGGCGCAAGCGAAAACCTCATGTCCCCCTCAGGATAATGGGAGGGGAAATGCAAAAAATCGTGTTCAAGATTCCCATGGTGGACGATAAGAGCCGTACAAAAGCAATGTCATTGGTTGCAAGTACGGTTGGAGTGCACTCGGTTGCAATCGCCGGTGACCTAAGAGACCAGGTTGTGGTGGTCGGTGATGGCATTGACTCCATCAATCTGGTCTCTGCGCTCCGGAAGAAGGTGGGCCCTGCGATGTTTCTGGAGGTCAGCCAAGTAAAGGAAGATGTGAAGGAGATAACGGCGATGCTTGCGCCGGTGAAATCCATATGTGAATTTCACGAGGTCAAAACAATTTGCATCCTTGGATTGCCAGGGGGAGGCAAAACAACGATTGCCCGAGTACTATATCATGCATTGGGAACGCAGTTCCAATGCCGGGTTTTCGCATCAATCTCTCCAAGTTCCAGCCCCAGTCCCAATCTAACAGAGACTCTTGCAGACATTTTCGCTCAAGCACAACTAGGAGTAACTGATACACTTAGCACACCATATGGTGGGAGTGGGACCGGGAGAGCTCTTCAACAACATCTCATCGACAACATATCAGCTTTCCTCCTCAACAAAAAGTATCTCATTGTAATCGATGACATTTGGCATTGGGAAGAATGGGAAGTCATCAGAAAGTCCATTCCCAAGAATGATCTGGGTGGTAGAATAATCATGACTACTCGTCTTAATTCAATAGCTGAGAAGTGCCACACTGATGACAATGATGTTTTTGTCTACGAAGTTGGGGATCTAGATAATAATGATGCTTGGTCGTTGTCTTGGGGGATAGCAACAAAGTCTGGGGCAGGCAACAGGATCGGAACTGGAGAGGATAATTCATGCTATGATATTGTGAACATGTGTTATGGTATGCCTTTAGCACTTATTTGGCTGTCGTCAGCATTGGTTGGAGAGATAGAAGAATTAGGTGGTGCTGAAGTGAAAAAATGTAGGGATTTGAGACACATAGAGGATGGTATTTTGGACATCCCATCCTTACAACCATTGGCGGAGAGTTTATGCCTTGGTTATAACCATCTTCCTCTTTATCTGAGGACTTTGTTGTTGTACTGTAGTGCATACCATTGGTCTAACAGAATCGAAAGGGGTCGTCTGGTCAGGAGGTGGATTGCGGAAGGATTTGTGTCGGAAGAGAAAGAAGCAGAAGGTTACTTTGGCGAGCTTATTAACAGAGGATGGATTACGCAGCACGGAGACAACAACAGTTATAATTACTATGAGATCCACCCCGTGATGCTGGCCTTCCTGAGATGCAAGTCCAAGGAGTACAATTTTTTAACATGCTTGGGTCTGGGATCTGATACTAGTACTAGTGCATCCTCCCCAAGGTTGATTCGCCGGCTGTCTCTTCAGGGGGGGTATCCAGTGGACTGCTTGTCAAGCATGAGTATGGATGTGTCACACACTTGCAGCCTTGTCGTCCTTGGTGACGTGGCGCGACCCAAGGGAATCCCCTTCTATATGTTTAAGCGCTTGCGAGTGTTGGACCTTGAAGATAATAAGGATATACAGGATTCTCATCTGCAGGGCATATGTGAACAGTTAAGCCTCAGAGTGAGGTACCTTGGTCTCAAGGGAACGCGGATCCGAAAGCTCCCTCAGGAGATGAGGAAGCTGAAGCATTTGGAGATTTTGTATGTGGGGAGCACTCGGATCAGTGAACTTCCGCAAGAGATTGGAGAGCTGAAGCATCTGCGGATTCTGGACGTGAGAAACACGGACATCACTGAGCTCCCACTGCAGATACGGGAGCTGCAGCATCTGCACACTCTGGACGTGAGGAACACTCCAATCAGTGAGCTCCCGCCGCAGGTTGGCAAGCTGCAGAATCTCAAGATTATGTGCGTGAGGAGCACTGGGGTTAGGGAGCTCCCAAAGGAGATTGGGGAGCTGAATCATCTACAGACTCTGGACGTGAGAAACACGAGGGTGAGAGAGCTGCCATGGCAAGCTGGCCAGATCTCCCAATCGTTGCGCGTGCTTGCCGGTGACAGTGGCGATGGCGTGCGGTTGCCCGAAGGCGTCTGCGAAGCTCTGATCAACGGTATTCCAGGGGCTACGCGTGCAAAATGCAGGGAGGTTCTGTCCATCGCGATCATCGATCGTTTCGGACCTCCCCTTGTTGGGATATTCAAAGTTCCCGGCAGTCATATGCGTATCCCGAAGATGATCAAAGACCACTTCCGCGTTCTTTCTTGCCTAGACATCAGGCTCTGCCACAAGCTTGAGGATGATGACCAAAAGTTCCTCGCCGAGATGCCCAACCTGCAGACGCTCGTGCTGAGGTTCGAGGCCCTACCAAGACAACCCATAACCATCAACGGCACAGGCTTCCAGATGCTGGAGAGCTTCCGTGTCGACAGCCGGGTGCCAAGGATAGCCTTCCATGAAGACGCCATGCCCAACCTCAAGCTTCTCGAGTTCAAGTTCTACGCCGGCCCAGCAAGCAACGATGCCATCGGCATCACCAACCTGAAGAGCCTCCAAAAGGTGGTCTTTCGGTGCTCGCCATGGTACAAGAGCGACGCCCCTGGCATCAGCGCCACCATTGACGTCGTGAAGAAAGAAGCCGAGGAGCATCCCAACCGGCCGATCACCCTCCTCATCAATGCTGGGTATAAGGAGATATCAACTGAGTCACACGGGAGCAGTGAAAACATTGCGGGCAGCAGTGGGATCGATACTGAGCCTGCACAGGCACAGCATGATAATCTCCCTGCTGTTCGAGATGACTACAAGGGAAAAGGGATTCTTCTTGATGGCAGGTGTCCTACCTGCGGCCGAGCGACTAAAATTGAAGAGGAAACCCAAGATCGAGTAGCAGATATTGAAATTCAAACAGAAACTACTAGCTAG


Protein sequences

Name Description Sequence
NBS-LRR class disease resistance protein NBS-LRR class disease resistance protein [Oryza sativa Japonica Group].

MEAAAMAVTAATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEERVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAGLVGMHKRKEELIELLEQGSSDASRWRKRKPHVPLRIMGGEMQKIVFKIPMVDDKSRTKAMSLVASTVGVHSVAIAGDLRDQVVVVGDGIDSINLVSALRKKVGPAMFLEVSQVKEDVKEITAMLAPVKSICEFHEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDAWSLSWGIATKSGAGNRIGTGEDNSCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTESHGSSENIAGSSGIDTEPAQAQHDNLPAVRDDYKGKGILLDGRCPTCGRATKIEEETQDRVADIEIQTETTS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-1072 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEERVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAGLVGMHKRKEELIELLEQGSSDASRWRKRKPHVPLRIMGGEMQKIVFKIPMVDDKSRTKAMSLVASTVGVHSVAIAGDLRDQVVVVGDGIDSINLVSALRKKVGPAMFLEVSQVKEDVKEITAMLAPVKSICEFHEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDAWSLSWGIATKSGAGNRIGTGEDNSCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTES

HMMPanther: PTHR23155:SF192
11-1072 PTHR23155:SF192,OS10G0132500 PROTEIN

ATGALAPVLVKLAALLDDGECNLLEGSRSDAEFIRSELEAVHSLLTPNILGRMGDDDAACKDGLIAEVRELSYDLDDAVDDFLELNFEQRRSASPFGELKARVEERVSNRFSDWKLPAASLPPSSVHRRAGLPPPDAGLVGMHKRKEELIELLEQGSSDASRWRKRKPHVPLRIMGGEMQKIVFKIPMVDDKSRTKAMSLVASTVGVHSVAIAGDLRDQVVVVGDGIDSINLVSALRKKVGPAMFLEVSQVKEDVKEITAMLAPVKSICEFHEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDAWSLSWGIATKSGAGNRIGTGEDNSCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEKEAEGYFGELINRGWITQHGDNNSYNYYEIHPVMLAFLRCKSKEYNFLTCLGLGSDTSTSASSPRLIRRLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYKSDAPGISATIDVVKKEAEEHPNRPITLLINAGYKEISTES

Gene3D: G3DSA:3.40.50.300
262-412 G3DSA:3.40.50.300

KEDVKEITAMLAPVKSICEFHEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTT

HMMPfam: PF00931
IPR002182
279-571 NB-ARC,NBS
NB-ARC

CEFHEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDAWSLSWGIATKSGAGNRIGTGEDNSCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGILDIPSLQPLAESLCLGYNHLPLYLRTLLLYCSAYHWSNRIERGRLVRRWIAEGFVSEEK

superfamily: SSF52540
282-512 SSF52540

HEVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVFVYEVGDLDNNDAWSLSWGIATKSGAGNRIGTGEDNSCYDIVNMCYGMPLALIWLSSALVGEIEELGGAEVKKCRDLRHIEDGI

HMMSmart: SM00382
IPR003593
283-429 AAA,NBS
AAA+ ATPase domain

EVKTICILGLPGGGKTTIARVLYHALGTQFQCRVFASISPSSSPSPNLTETLADIFAQAQLGVTDTLSTPYGGSGTGRALQQHLIDNISAFLLNKKYLIVIDDIWHWEEWEVIRKSIPKNDLGGRIIMTTRLNSIAEKCHTDDNDVF

FPrintScan: PR00364
IPR000767
286-301 DISEASERSIST
Disease resistance protein

TICILGLPGGGKTTIA

FPrintScan: PR00364
IPR000767
373-387 DISEASERSIST
Disease resistance protein

FLLNKKYLIVIDDIW

FPrintScan: PR00364
IPR000767
473-487 DISEASERSIST
Disease resistance protein

CYGMPLALIWLSSAL

Gene3D: G3DSA:3.80.10.10
514-536 G3DSA:3.80.10.10

DIPSLQPLAESLCLGYNHLPLYL

superfamily: SSF52047
639-1032 SSF52047,LRR

RLSLQGGYPVDCLSSMSMDVSHTCSLVVLGDVARPKGIPFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALINGIPGATRAKCREVLSIAIIDRFGPPLVGIFKVPGSHMRIPKMIKDHFRVLSCLDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSRVPRIAFHEDAMPNLKLLEFKFYAGPASNDAIGITNLKSLQKVVFRCSPWYK

Gene3D: G3DSA:3.80.10.10
677-873 G3DSA:3.80.10.10

PFYMFKRLRVLDLEDNKDIQDSHLQGICEQLSLRVRYLGLKGTRIRKLPQEMRKLKHLEILYVGSTRISELPQEIGELKHLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPPQVGKLQNLKIMCVRSTGVRELPKEIGELNHLQTLDVRNTRVRELPWQAGQISQSLRVLAGDSGDGVRLPEGVCEALIN

FPrintScan: PR00364
IPR000767
679-695 DISEASERSIST
Disease resistance protein

YMFKRLRVLDLEDNKDI

HMMPfam: PF12799
756-795 LRR_4,Leucine Rich repeats (2 copies)

HLRILDVRNTDITELPLQIRELQHLHTLDVRNTPISELPP

Gene3D: G3DSA:3.80.10.10
926-981 G3DSA:3.80.10.10

LDIRLCHKLEDDDQKFLAEMPNLQTLVLRFEALPRQPITINGTGFQMLESFRVDSR


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox