PRGDB00061454 (Pikm2-TS)

From PRG Wiki
Jump to: navigation, search
Pikm2-TS
Gene Type Reference_R-Genes,_manually_curated
GenBank 207367331 (AB462325)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 11
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Pikm2-TS mRNA for NBS-LRR class disease resistance protein, complete cds.

DNA Sequence

ATGGAGTTGGTGGTAGGTGCTTCCGAAGCCACCATGAAATCTCTCTTGGGCAAGCTGGGCAATCTTCTAGCCCAGGAGTATGCTCTCATCAGCGGTATCCGTGGTGACATCCAGTACATCAATGACGAGCTTGCCAGCATGCAGGCCTTCCTCCGTGATCTCAGCAACGTGCCAGAGGGTCACAGTCATGGCCACCGGATGAAGGACTGGATGAAGCAGATCCGAGACATCGCCTATGATGTTGAGGACTGTATCGATGACTTTGCCCACCGCCTCCCTCAGGATTCCATCAGCGATGCCAAATGGTCCTTCCTACTCACAAAAATCTATGAACTATGGACATGGTGGCCACGTCGTGTGATTGCTTCCAACATTGCCCAACTCAAGGTACGGGCACAACAGATCGCAGATCGACGTAGTAGATACGGAGTGAACAACCCAGAACACCTTGACAGTAGCAGCAGTGCCAGGACCCGTGCTGTCAATTACGAAATTGCTGAGTATCAGGTCACAAGCCCTCAGATCATTGGTATAAAGGAGCCTGTGGGGATGAAGACGGTCATGGAGGAGCTTGAGGTTTGGTTAACTAATCCTCAAGCTGAAAATGGGCAAGCTGTTCTGTCCATAGTCGGTTTTGGAGGTGTGGGAAAGACTACCATTGCCACAGCATTGTACAGAAAAGTCAGTGAAAAATTTCAGTGCCGGGCATCAGTAGCTGTGTCTCAGAACTATGACCAAGGCAAAGTCCTCAATAGTATTCTGAGTCAAGTCAGCAATCAGGAGCAGGGCAGCAGCACAACAATTAGTGAGAAAAAGAACCTCACCTCAGGCGCTAAGAGCATGTTGAAGACAGCCCTGTCACTGCTCAGAGGTAATTGTATATGTCAGCCAGAAAATGATGGAAACCCTGATAATACACCAATCAGGCTGCAGGAAACAACGGACGATGATCAAAACCCCAGAAAACTGGAACAGCTCCTGGCCGAAAAGAGTTATATCCTCTTGATTGATGACATTTGGTCTGCCGAAACATGGGAGAGTATCAGATCGATTTTGCCTAAAAATAATAAAGGCGGTAGAATAATAGTGACTACAAGATTTCAAGCTGTTGGTTCAACATGCTCCCCTCTTGAAACTGATCGTTTGCATACAGTTGATTTTCTCACCGATGACGAGTCCCAAAACTTATTCAATACAAGTATTTGTGAATCAAAGATAAGAAAAGATAGCAACAAAGTAGACGAGCAAGTCCCTGAGGAAATATGGAAAATATGTGGGGGATTGCCTTTGGCCATAGTCAGCATGGCTGGTCTTGTCGCCTGCAACCCAAGGAAAGCCTGCTGCGATTGGAGTAAACTTTGCAAATCATTATTTCCAGAGCAAGAAACTCCTCTTACCCTCGATGGTGTTACAAGGATACTGGATTGTTGTTACAATGATTTGCCTGCGGATCTGAAGACTTGCTTATTGTACTTGAGTATATTTCCGAAGGGTTGGAAAATTAGTAGGAAACGTTTGTCCCGGCGATGGATAGCTGAAGGTTTTGCTAATGAGAAGCAAGGGTTAACCCAGGAAAGAGTTGCAGAGGCATACTTTAATCAACTCACAAGAAGGAACTTAGTACGTCCCATGGAGCATGGCAGCAATGGGAAGGTAAAAACGTTTCAAGTTCATGACATGGTTCTTGAATACATCATGTCCAAATCAATCGAAGAGAATTTTATTACTGTGGTTGGTGGACACTGGCAGATGACTGCACCAAGCAATAAAGTCCGTCGACTGTCGATGCAAAGCAGTGGATCCAATCGTGGAAGTTCAACAAAAGGCCTGAACTTGGCTCAAGTGAGATCACTGACGGTGTTTGGGAACCTGAACCATGTGCCATTCCATTCATTCAACTATGGGATAATACAGGTGCTGGATCTTGAGGACTGGAAGGGTTTGAAAGAGAGACATATGACGGAGATATGTCAAATGCTTTTACTCAAGTATTTGAGCATCCGACGAACAGAAATTTCCAAAATTCCCTCCAAGATTCAGAAACTTGAGTACTTGGAAACTCTTGACATAAGGGAGACATATGTCAGGGACCTGCCTAAGTCAATAGTCCAGCTAAAACGGATCATTAGCATACTTGGAGGGAATAAAAACACACGGAAGGGGCTGAGGTTGCCTCAAGAAAAAAGTAAGAAGCCAATTAAAAACCCGTCGCCTCAAGGAAAAACAAAGGAGCCCGCAAAGAAAGGATTCTTATCCCAAGAAAAAGGTAAAGGCGCAATGAAAGCACTCCGTGTACTGTCAGGGATTGAGATTGTTGAGGAATCATCAGAAGTAGCTGCAGGCCTTCATCAGTTGACAGGGCTAAGGAAGCTTGCCATATACAAGCTCAATATAACAAAGGGTGGTGATACCTTCAAACAATTACAGTCCTCCATTGAGTACCTTGGCAGCTGTGGTCTGCAGACTCTGGCCATCAATGATGAGAATTCTGAATTTATCAACTCACTGGGCGACATGCCCGCGCCTCCAAGATATCTTGTCGCCCTTGAGCTGTCTGGCAAGTTGGAGAAGCTACCCAAGTGGATCACCAGCATCACTACTCTCAACAAGCTAACCATATCTGTAACAGTTCTTAGGACTGAAACTTTGGAGATCCTCCACATTTTACCTTCATTGTTTTCCCTCACCTTCGCCTTTTCACTTAGTGCAGCGAAGCAGGATCAGGACATAATAAAGGACATCCTTGAGAATAATAAATTGGACAGTGATGGGGAAATCGTCATTCCAGCTGAAGGATTCAAGAGTCTTAAGCTGCTTCGCTTCTTTGCACCTTTAGTGCCGAAGCTCAGCTTTTTGGACAAGAATGCAATGCCAGCACTCGAAATCATTGAAATGCGGTTTAAAGACTTCGAAGGTCTATTTGGCATCGAAATCCTTGAAAATCTCCGTGAGGTGCATCTCAAAGTTAGTGATGGGGCAGAAGCAATAACCAAGTTCCTTGTAAATGATTTGAAGGTTAATACTGAGAAACCAAAAGTATTTGTTGATGGCATCGTCACTGCATGA


Protein sequences

Name Description Sequence
NBS-LRR class disease resistance protein NBS-LRR class disease resistance protein [Oryza sativa Japonica Group].

MELVVGASEATMKSLLGKLGNLLAQEYALISGIRGDIQYINDELASMQAFLRDLSNVPEGHSHGHRMKDWMKQIRDIAYDVEDCIDDFAHRLPQDSISDAKWSFLLTKIYELWTWWPRRVIASNIAQLKVRAQQIADRRSRYGVNNPEHLDSSSSARTRAVNYEIAEYQVTSPQIIGIKEPVGMKTVMEELEVWLTNPQAENGQAVLSIVGFGGVGKTTIATALYRKVSEKFQCRASVAVSQNYDQGKVLNSILSQVSNQEQGSSTTISEKKNLTSGAKSMLKTALSLLRGNCICQPENDGNPDNTPIRLQETTDDDQNPRKLEQLLAEKSYILLIDDIWSAETWESIRSILPKNNKGGRIIVTTRFQAVGSTCSPLETDRLHTVDFLTDDESQNLFNTSICESKIRKDSNKVDEQVPEEIWKICGGLPLAIVSMAGLVACNPRKACCDWSKLCKSLFPEQETPLTLDGVTRILDCCYNDLPADLKTCLLYLSIFPKGWKISRKRLSRRWIAEGFANEKQGLTQERVAEAYFNQLTRRNLVRPMEHGSNGKVKTFQVHDMVLEYIMSKSIEENFITVVGGHWQMTAPSNKVRRLSMQSSGSNRGSSTKGLNLAQVRSLTVFGNLNHVPFHSFNYGIIQVLDLEDWKGLKERHMTEICQMLLLKYLSIRRTEISKIPSKIQKLEYLETLDIRETYVRDLPKSIVQLKRIISILGGNKNTRKGLRLPQEKSKKPIKNPSPQGKTKEPAKKGFLSQEKGKGAMKALRVLSGIEIVEESSEVAAGLHQLTGLRKLAIYKLNITKGGDTFKQLQSSIEYLGSCGLQTLAINDENSEFINSLGDMPAPPRYLVALELSGKLEKLPKWITSITTLNKLTISVTVLRTETLEILHILPSLFSLTFAFSLSAAKQDQDIIKDILENNKLDSDGEIVIPAEGFKSLKLLRFFAPLVPKLSFLDKNAMPALEIIEMRFKDFEGLFGIEILENLREVHLKVSDGAEAITKFLVNDLKVNTEKPKVFVDGIVTA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
8-987 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SEATMKSLLGKLGNLLAQEYALISGIRGDIQYINDELASMQAFLRDLSNVPEGHSHGHRMKDWMKQIRDIAYDVEDCIDDFAHRLPQDSISDAKWSFLLTKIYELWTWWPRRVIASNIAQLKVRAQQIADRRSRYGVNNPEHLDSSSSARTRAVNYEIAEYQVTSPQIIGIKEPVGMKTVMEELEVWLTNPQAENGQAVLSIVGFGGVGKTTIATALYRKVSEKFQCRASVAVSQNYDQGKVLNSILSQVSNQEQGSSTTISEKKNLTSGAKSMLKTALSLLRGNCICQPENDGNPDNTPIRLQETTDDDQNPRKLEQLLAEKSYILLIDDIWSAETWESIRSILPKNNKGGRIIVTTRFQAVGSTCSPLETDRLHTVDFLTDDESQNLFNTSICESKIRKDSNKVDEQVPEEIWKICGGLPLAIVSMAGLVACNPRKACCDWSKLCKSLFPEQETPLTLDGVTRILDCCYNDLPADLKTCLLYLSIFPKGWKISRKRLSRRWIAEGFANEKQGLTQERVAEAYFNQLTRRNLVRPMEHGSNGKVKTFQVHDMVLEYIMSKSIEENFITVVGGHWQMTAPSNKVRRLSMQSSGSNRGSSTKGLNLAQVRSLTVFGNLNHVPFHSFNYGIIQVLDLEDWKGLKERHMTEICQMLLLKYLSIRRTEISKIPSKIQKLEYLETLDIRETYVRDLPKSIVQLKRIISILGGNKNTRKGLRLPQEKSKKPIKNPSPQGKTKEPAKKGFLSQEKGKGAMKALRVLSGIEIVEESSEVAAGLHQLTGLRKLAIYKLNITKGGDTFKQLQSSIEYLGSCGLQTLAINDENSEFINSLGDMPAPPRYLVALELSGKLEKLPKWITSITTLNKLTISVTVLRTETLEILHILPSLFSLTFAFSLSAAKQDQDIIKDILENNKLDSDGEIVIPAEGFKSLKLLRFFAPLVPKLSFLDKNAMPALEIIEMRFKDFEGLFGIEILENLREVHL

HMMPanther: PTHR23155:SF220
8-987 OS11G0689100 PROTEIN,OS11G0689100 PROTEIN

SEATMKSLLGKLGNLLAQEYALISGIRGDIQYINDELASMQAFLRDLSNVPEGHSHGHRMKDWMKQIRDIAYDVEDCIDDFAHRLPQDSISDAKWSFLLTKIYELWTWWPRRVIASNIAQLKVRAQQIADRRSRYGVNNPEHLDSSSSARTRAVNYEIAEYQVTSPQIIGIKEPVGMKTVMEELEVWLTNPQAENGQAVLSIVGFGGVGKTTIATALYRKVSEKFQCRASVAVSQNYDQGKVLNSILSQVSNQEQGSSTTISEKKNLTSGAKSMLKTALSLLRGNCICQPENDGNPDNTPIRLQETTDDDQNPRKLEQLLAEKSYILLIDDIWSAETWESIRSILPKNNKGGRIIVTTRFQAVGSTCSPLETDRLHTVDFLTDDESQNLFNTSICESKIRKDSNKVDEQVPEEIWKICGGLPLAIVSMAGLVACNPRKACCDWSKLCKSLFPEQETPLTLDGVTRILDCCYNDLPADLKTCLLYLSIFPKGWKISRKRLSRRWIAEGFANEKQGLTQERVAEAYFNQLTRRNLVRPMEHGSNGKVKTFQVHDMVLEYIMSKSIEENFITVVGGHWQMTAPSNKVRRLSMQSSGSNRGSSTKGLNLAQVRSLTVFGNLNHVPFHSFNYGIIQVLDLEDWKGLKERHMTEICQMLLLKYLSIRRTEISKIPSKIQKLEYLETLDIRETYVRDLPKSIVQLKRIISILGGNKNTRKGLRLPQEKSKKPIKNPSPQGKTKEPAKKGFLSQEKGKGAMKALRVLSGIEIVEESSEVAAGLHQLTGLRKLAIYKLNITKGGDTFKQLQSSIEYLGSCGLQTLAINDENSEFINSLGDMPAPPRYLVALELSGKLEKLPKWITSITTLNKLTISVTVLRTETLEILHILPSLFSLTFAFSLSAAKQDQDIIKDILENNKLDSDGEIVIPAEGFKSLKLLRFFAPLVPKLSFLDKNAMPALEIIEMRFKDFEGLFGIEILENLREVHL

superfamily: SSF52540
163-441 P-loop containing nucleoside triphosphate hydrolases

YEIAEYQVTSPQIIGIKEPVGMKTVMEELEVWLTNPQAENGQAVLSIVGFGGVGKTTIATALYRKVSEKFQCRASVAVSQNYDQGKVLNSILSQVSNQEQGSSTTISEKKNLTSGAKSMLKTALSLLRGNCICQPENDGNPDNTPIRLQETTDDDQNPRKLEQLLAEKSYILLIDDIWSAETWESIRSILPKNNKGGRIIVTTRFQAVGSTCSPLETDRLHTVDFLTDDESQNLFNTSICESKIRKDSNKVDEQVPEEIWKICGGLPLAIVSMAGLVAC

HMMPfam: PF00931
IPR002182
187-519 NB-ARC,NBS
NB-ARC

VMEELEVWLTNPQAENGQAVLSIVGFGGVGKTTIATALYRKVSEKFQCRASVAVSQNYDQGKVLNSILSQVSNQEQGSSTTISEKKNLTSGAKSMLKTALSLLRGNCICQPENDGNPDNTPIRLQETTDDDQNPRKLEQLLAEKSYILLIDDIWSAETWESIRSILPKNNKGGRIIVTTRFQAVGSTCSPLETDRLHTVDFLTDDESQNLFNTSICESKIRKDSNKVDEQVPEEIWKICGGLPLAIVSMAGLVACNPRKACCDWSKLCKSLFPEQETPLTLDGVTRILDCCYNDLPADLKTCLLYLSIFPKGWKISRKRLSRRWIAEGFANEK

FPrintScan: PR00364
IPR000767
206-221 DISEASERSIST
Disease resistance protein

VLSIVGFGGVGKTTIA

Gene3D: G3DSA:3.40.50.300
317-366 no description

DQNPRKLEQLLAEKSYILLIDDIWSAETWESIRSILPKNNKGGRIIVTTR

FPrintScan: PR00364
IPR000767
425-439 DISEASERSIST
Disease resistance protein

CGGLPLAIVSMAGLV

superfamily: SSF52058
556-987 L domain-like,LRR

QVHDMVLEYIMSKSIEENFITVVGGHWQMTAPSNKVRRLSMQSSGSNRGSSTKGLNLAQVRSLTVFGNLNHVPFHSFNYGIIQVLDLEDWKGLKERHMTEICQMLLLKYLSIRRTEISKIPSKIQKLEYLETLDIRETYVRDLPKSIVQLKRIISILGGNKNTRKGLRLPQEKSKKPIKNPSPQGKTKEPAKKGFLSQEKGKGAMKALRVLSGIEIVEESSEVAAGLHQLTGLRKLAIYKLNITKGGDTFKQLQSSIEYLGSCGLQTLAINDENSEFINSLGDMPAPPRYLVALELSGKLEKLPKWITSITTLNKLTISVTVLRTETLEILHILPSLFSLTFAFSLSAAKQDQDIIKDILENNKLDSDGEIVIPAEGFKSLKLLRFFAPLVPKLSFLDKNAMPALEIIEMRFKDFEGLFGIEILENLREVHL

Seg: seg
595-609 seg

SMQSSGSNRGSSTKG

FPrintScan: PR00364
IPR000767
680-696 DISEASERSIST
Disease resistance protein

QKLEYLETLDIRETYVR

Seg: seg
768-781 seg

GIEIVEESSEVAAG

Gene3D: G3DSA:3.80.10.10
775-898 no description

SSEVAAGLHQLTGLRKLAIYKLNITKGGDTFKQLQSSIEYLGSCGLQTLAINDENSEFINSLGDMPAPPRYLVALELSGKLEKLPKWITSITTLNKLTISVTVLRTETLEILHILPSLFSLTFA

Seg: seg
891-904 seg

SLFSLTFAFSLSAA


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References

Ikuo Ashikawa, Nagao Hayashi, Hiroko Yamane, Hiroyuki Kanamori, Jianzhong Wu, Takashi Matsumoto, Kazuko Ono, Masahiro Yano
Two adjacent nucleotide-binding site-leucine-rich repeat class genes are required to confer Pikm-specific rice blast resistance.
Genetics: 2008, 180(4);2267-76
PubMed:18940787 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox