PRGDB00061455 (Pid2)

From PRG Wiki
Jump to: navigation, search
Pid2
Gene Type Reference_R-Genes,_manually_curated
GenBank 237824129 (FJ915121)
Gene Class Other
Domain Type Ser-Thr Kinase
Chromosome 6
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa Indica Group cultivar Digu B-lectin receptor kinase (Pid2) gene, complete cds.

DNA Sequence

ATGCAAATGTGTGGATGGTTACTGAAGGTTGTTCGTTGGGAAAACTTAAATTGTGTGCACATGGAAGCTCATGGCAATCGTCGCAGCAGTCCAACATACCTTGTTATGCTGTGGATGATTTCGGTAGCTAGCCTATTGATAACATGTCGTGGCAGTATCCAGAAGCAAGTTCTCTTTCCAGGGTTCACTGCCGCGCAAATGGATTACATTGATAACGATGGGATATTTCTGCTTTCTAATGGCTCTGTCTTTGGCTTTGGTTTTGTCACGAGCAATGTCTCAGACAACACGTTCTACATTCTTGCAGTGGTTCACATGGCCACTACTACCACAGTCTGGTCTGCCAATCCTAACTCTCCTGTCACCCATTCAGATGACTTTTTTTTCGACAAGGATGGCAATGCCTTCCTGCAGTCAGGAGGAGGCTCCAATGTATGGGCTGCCAATATCTCCGGGAAAGGGACTGCCACCTCTATGCAACTACTGGACTCTGGCAATCTTGTAGTGCTTGGGAAAGATGCCTCTTCTCCTCTCTGGCAAAGTTTCAGCCATCCGACAGACACTCTTCTGTCTGGTCAGAATTTCATCGAAGGGATGACGCTGATGAGCAAGTCCAACACAGTACAGAACATGACCTATACACTTCAGATCAAATCTGGGAACATGATGTTATACGCCGGCTTCGAGACACCTCAACCATACTGGTCTGCACAGCAGGATAGCAGGATAATTGTCAACAAGAACGGTGACAGCATCTACTCTGCAAACCTCAGTTCAGCTTCTTGGTCCTTCTATGATCAATCAGGGTCCCTTCTATCACAACTTGTCATCGCGCAAGAAAATGCCAATGCCACATTGTCTGCTGTCCTTGGTAGTGATGGATTGATAGCTTTCTATATGCTGCAGGGTGGAAATGGCAAGAGTAAATTCTCGATCACAGTTCCGGCAGACTCTTGTGACATGCCAGCCTACTGCAGTCCTTACACCATTTGCAGTAGTGGGACAGGTTGCCAATGCCCTTCGGCCCTCGGCTCGTTTGCAAACTGCAATCCTGGTGTTACATCAGCATGCAAATCGAACGAGGAGTTTCCGCTGGTTCAACTGGATAGTGGAGTTGGATATGTAGGCACTAACTTCTTCCCTCCTGCGGCTAAGACGAACCTTACGGGTTGTAAGAGTGCCTGTACAGGCAACTGCTCTTGTGTTGCTGTGTTCTTTGATCAATCTTCAGGCAATTGTTTCCTTTTCAACCAGATCGGAAGCTTGCAGCACAAAGGTGGGAATACAACTCGTTTCGCATCTTTTATCAAGGTATCAAGCAGAGGAAAAGGTGGGAGTGATAGTGGCAGTGGGAAGCACAATACCATTATTATTGTCATTATACTCGGAACTTTGGCTATCATAGGCGTCCTTATTTATATTGGTTTCTGGATCTACAAGAGGAAGAGGCATCCTCCACCATCACAAGACGACGCTGGTTCATCGGAAGATGATGGATTTCTGCAAACAATATCCGGAGCACCAGTGCGGTTCACTTACAGGGAGCTCCAGGATGCGACAAGCAACTTCTGTAACAAGCTTGGTCAGGGAGGGTTTGGATCTGTGTATCTTGGTACACTCCCAGACGGCAGTCGTATTGCTGTGAAGAAGCTGGAGGGCATAGGCCAAGGAAAGAAAGAGTTCCGCTCTGAGGTAACGATCATTGGTAGTATCCACCACATCCATCTTGTCAAACTCCGAGGCTTTTGTACTGAGGGACCACACAGGCTTCTTGCCTACGAGTACATGGCGAATGGGTCGCTGGATAAGTGGATTTTCCATTCTAAAGAAGATGATCACCTGCTCGACTGGGATACAAGGTTTAACATTGCGCTTGGAACGGCAAAGGGATTGGCATACCTCCATCAGGACTGCGATTCGAAGATTGTACACTGTGACATTAAGCCTGAGAATGTTCTACTTGACGACAACTTCATCGCAAAGGTATCTGATTTTGGCCTTGCCAAGTTGATGACCAGGGAGCAGAGCCATGTTTTCACTACGCTCAGAGGCACGCATGGGTACCTTGCACCTGAGTGGCTCACCAACTATGCCATCTCAGAGAAGAGTGATGTGTACAGCTACGGCATGGTTTTGCTTGAGATAATCGGTGGGAGGAAGAGCTACGATCCCTCGGAGATCTCCGAGAAGGCTCACTTCCCTTCCTTTGCATTCAAGAAGCTGGAGGAAGGTGATCTTCAGGACATCTTCGACGCCAAGCTGAAGTACAATGACAAGGATGGGCGGGTCGAGACCGCGATCAAGGTCGCGCTCTGGTGCATCCAGGATGATTTCTACCAGAGACCATCCATGTCAAAGGTTGTGCAGATGCTCGAAGGCGTCTGCGAGGTGCTCCAGCCACCGGTGTCGTCGCAGATCGGGTACAGGCTCTACGCAAACGCCTTCAAATCGAGCAGCGAGGAGGGGACTTCATCAGGGATGTCGGACTACAACAGTGATGCTCTGCTTTCAGCTGTGAGGCTCTCTGGTCCCAGATGA


Protein sequences

Name Description Sequence
B-lectin receptor kinase B-lectin receptor kinase [Oryza sativa Indica Group].

MQMCGWLLKVVRWENLNCVHMEAHGNRRSSPTYLVMLWMISVASLLITCRGSIQKQVLFPGFTAAQMDYIDNDGIFLLSNGSVFGFGFVTSNVSDNTFYILAVVHMATTTTVWSANPNSPVTHSDDFFFDKDGNAFLQSGGGSNVWAANISGKGTATSMQLLDSGNLVVLGKDASSPLWQSFSHPTDTLLSGQNFIEGMTLMSKSNTVQNMTYTLQIKSGNMMLYAGFETPQPYWSAQQDSRIIVNKNGDSIYSANLSSASWSFYDQSGSLLSQLVIAQENANATLSAVLGSDGLIAFYMLQGGNGKSKFSITVPADSCDMPAYCSPYTICSSGTGCQCPSALGSFANCNPGVTSACKSNEEFPLVQLDSGVGYVGTNFFPPAAKTNLTGCKSACTGNCSCVAVFFDQSSGNCFLFNQIGSLQHKGGNTTRFASFIKVSSRGKGGSDSGSGKHNTIIIVIILGTLAIIGVLIYIGFWIYKRKRHPPPSQDDAGSSEDDGFLQTISGAPVRFTYRELQDATSNFCNKLGQGGFGSVYLGTLPDGSRIAVKKLEGIGQGKKEFRSEVTIIGSIHHIHLVKLRGFCTEGPHRLLAYEYMANGSLDKWIFHSKEDDHLLDWDTRFNIALGTAKGLAYLHQDCDSKIVHCDIKPENVLLDDNFIAKVSDFGLAKLMTREQSHVFTTLRGTHGYLAPEWLTNYAISEKSDVYSYGMVLLEIIGGRKSYDPSEISEKAHFPSFAFKKLEEGDLQDIFDAKLKYNDKDGRVETAIKVALWCIQDDFYQRPSMSKVVQMLEGVCEVLQPPVSSQIGYRLYANAFKSSSEEGTSSGMSDYNSDALLSAVRLSGPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
26-806 PTHR24420,FAMILY NOT NAMED

NRRSSPTYLVMLWMISVASLLITCRGSIQKQVLFPGFTAAQMDYIDNDGIFLLSNGSVFGFGFVTSNVSDNTFYILAVVHMATTTTVWSANPNSPVTHSDDFFFDKDGNAFLQSGGGSNVWAANISGKGTATSMQLLDSGNLVVLGKDASSPLWQSFSHPTDTLLSGQNFIEGMTLMSKSNTVQNMTYTLQIKSGNMMLYAGFETPQPYWSAQQDSRIIVNKNGDSIYSANLSSASWSFYDQSGSLLSQLVIAQENANATLSAVLGSDGLIAFYMLQGGNGKSKFSITVPADSCDMPAYCSPYTICSSGTGCQCPSALGSFANCNPGVTSACKSNEEFPLVQLDSGVGYVGTNFFPPAAKTNLTGCKSACTGNCSCVAVFFDQSSGNCFLFNQIGSLQHKGGNTTRFASFIKVSSRGKGGSDSGSGKHNTIIIVIILGTLAIIGVLIYIGFWIYKRKRHPPPSQDDAGSSEDDGFLQTISGAPVRFTYRELQDATSNFCNKLGQGGFGSVYLGTLPDGSRIAVKKLEGIGQGKKEFRSEVTIIGSIHHIHLVKLRGFCTEGPHRLLAYEYMANGSLDKWIFHSKEDDHLLDWDTRFNIALGTAKGLAYLHQDCDSKIVHCDIKPENVLLDDNFIAKVSDFGLAKLMTREQSHVFTTLRGTHGYLAPEWLTNYAISEKSDVYSYGMVLLEIIGGRKSYDPSEISEKAHFPSFAFKKLEEGDLQDIFDAKLKYNDKDGRVETAIKVALWCIQDDFYQRPSMSKVVQMLEGVCEVLQPPVSSQI

HMMPanther: PTHR24420:SF926
26-806 PTHR24420:SF926

NRRSSPTYLVMLWMISVASLLITCRGSIQKQVLFPGFTAAQMDYIDNDGIFLLSNGSVFGFGFVTSNVSDNTFYILAVVHMATTTTVWSANPNSPVTHSDDFFFDKDGNAFLQSGGGSNVWAANISGKGTATSMQLLDSGNLVVLGKDASSPLWQSFSHPTDTLLSGQNFIEGMTLMSKSNTVQNMTYTLQIKSGNMMLYAGFETPQPYWSAQQDSRIIVNKNGDSIYSANLSSASWSFYDQSGSLLSQLVIAQENANATLSAVLGSDGLIAFYMLQGGNGKSKFSITVPADSCDMPAYCSPYTICSSGTGCQCPSALGSFANCNPGVTSACKSNEEFPLVQLDSGVGYVGTNFFPPAAKTNLTGCKSACTGNCSCVAVFFDQSSGNCFLFNQIGSLQHKGGNTTRFASFIKVSSRGKGGSDSGSGKHNTIIIVIILGTLAIIGVLIYIGFWIYKRKRHPPPSQDDAGSSEDDGFLQTISGAPVRFTYRELQDATSNFCNKLGQGGFGSVYLGTLPDGSRIAVKKLEGIGQGKKEFRSEVTIIGSIHHIHLVKLRGFCTEGPHRLLAYEYMANGSLDKWIFHSKEDDHLLDWDTRFNIALGTAKGLAYLHQDCDSKIVHCDIKPENVLLDDNFIAKVSDFGLAKLMTREQSHVFTTLRGTHGYLAPEWLTNYAISEKSDVYSYGMVLLEIIGGRKSYDPSEISEKAHFPSFAFKKLEEGDLQDIFDAKLKYNDKDGRVETAIKVALWCIQDDFYQRPSMSKVVQMLEGVCEVLQPPVSSQI

HMMPIR: PIRSF000641
IPR024171
36-842 SRK
S-receptor-like serine/threonine-protein kinase

MLWMISVASLLITCRGSIQKQVLFPGFTAAQMDYIDNDGIFLLSNGSVFGFGFVTSNVSDNTFYILAVVHMATTTTVWSANPNSPVTHSDDFFFDKDGNAFLQSGGGSNVWAANISGKGTATSMQLLDSGNLVVLGKDASSPLWQSFSHPTDTLLSGQNFIEGMTLMSKSNTVQNMTYTLQIKSGNMMLYAGFETPQPYWSAQQDSRIIVNKNGDSIYSANLSSASWSFYDQSGSLLSQLVIAQENANATLSAVLGSDGLIAFYMLQGGNGKSKFSITVPADSCDMPAYCSPYTICSSGTGCQCPSALGSFANCNPGVTSACKSNEEFPLVQLDSGVGYVGTNFFPPAAKTNLTGCKSACTGNCSCVAVFFDQSSGNCFLFNQIGSLQHKGGNTTRFASFIKVSSRGKGGSDSGSGKHNTIIIVIILGTLAIIGVLIYIGFWIYKRKRHPPPSQDDAGSSEDDGFLQTISGAPVRFTYRELQDATSNFCNKLGQGGFGSVYLGTLPDGSRIAVKKLEGIGQGKKEFRSEVTIIGSIHHIHLVKLRGFCTEGPHRLLAYEYMANGSLDKWIFHSKEDDHLLDWDTRFNIALGTAKGLAYLHQDCDSKIVHCDIKPENVLLDDNFIAKVSDFGLAKLMTREQSHVFTTLRGTHGYLAPEWLTNYAISEKSDVYSYGMVLLEIIGGRKSYDPSEISEKAHFPSFAFKKLEEGDLQDIFDAKLKYNDKDGRVETAIKVALWCIQDDFYQRPSMSKVVQMLEGVCEVLQPPVSSQIGYRLYANAFKSSSEEGTSSGMSDYNSDALLSAVRLS

ProfileScan: PS50927
IPR001480
61-182 BULB_LECTIN
Bulb-type lectin domain

GFTAAQMDYIDNDGIFLLSNGSVFGFGFVTSNVSDNTFYILAVVHMATTTTVWSANPNSPVTHSDDFFFDKDGNAFLQSGGGSNVWAANISGKGTATSMQLLDSGNLVVLGKDASSPLWQSF

HMMSmart: SM00108
IPR001480
68-185 B_lectin
Bulb-type lectin domain

DYIDNDGIFLLSNGSVFGFGFVTSNVSDNTFYILAVVHMATTTTVWSANPNSPVTHSDDFFFDKDGNAFLQSGGGSNVWAANISGKGTATSMQLLDSGNLVVLGKDASSPLWQSFSHP

superfamily: SSF51110
IPR001480
93-237 B_lectin
Bulb-type lectin domain

VSDNTFYILAVVHMATTTTVWSANPNSPVTHSDDFFFDKDGNAFLQSGGGSNVWAANISGKGTATSMQLLDSGNLVVLGKDASSPLWQSFSHPTDTLLSGQNFIEGMTLMSKSNTVQNMTYTLQIKSGNMMLYAGFETPQPYWSA

Gene3D: G3DSA:2.90.10.10
IPR001480
108-242 Bulb-type_lectin_dom
Bulb-type lectin domain

TTTTVWSANPNSPVTHSDDFFFDKDGNAFLQSGGGSNVWAANISGKGTATSMQLLDSGNLVVLGKDASSPLWQSFSHPTDTLLSGQNFIEGMTLMSKSNTVQNMTYTLQIKSGNMMLYAGFETPQPYWSAQQDSR

HMMPfam: PF01453
IPR001480
109-198 B_lectin
Bulb-type lectin domain

TTTVWSANPNSPVTHSDDFFFDKDGNAFLQSGGGSNVWAANISGKGTATSMQLLDSGNLVVLGKDASSPLWQSFSHPTDTLLSGQNFIEG

Gene3D: G3DSA:3.30.200.20
507-596 G3DSA:3.30.200.20

APVRFTYRELQDATSNFCNKLGQGGFGSVYLGTLPDGSRIAVKKLEGIGQGKKEFRSEVTIIGSIHHIHLVKLRGFCTEGPHRLLAYEYM

superfamily: SSF56112
IPR011009
509-822 Kinase_like
Protein kinase-like domain

VRFTYRELQDATSNFCNKLGQGGFGSVYLGTLPDGSRIAVKKLEGIGQGKKEFRSEVTIIGSIHHIHLVKLRGFCTEGPHRLLAYEYMANGSLDKWIFHSKEDDHLLDWDTRFNIALGTAKGLAYLHQDCDSKIVHCDIKPENVLLDDNFIAKVSDFGLAKLMTREQSHVFTTLRGTHGYLAPEWLTNYAISEKSDVYSYGMVLLEIIGGRKSYDPSEISEKAHFPSFAFKKLEEGDLQDIFDAKLKYNDKDGRVETAIKVALWCIQDDFYQRPSMSKVVQMLEGVCEVLQPPVSSQIGYRLYANAFKSSSEEG

ProfileScan: PS50011
IPR000719
521-802 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SNFCNKLGQGGFGSVYLGTLPDGSRIAVKKLEGIGQGKKEFRSEVTIIGSIHHIHLVKLRGFCTEGPHRLLAYEYMANGSLDKWIFHSKEDDHLLDWDTRFNIALGTAKGLAYLHQDCDSKIVHCDIKPENVLLDDNFIAKVSDFGLAKLMTREQSHVFTTLRGTHGYLAPEWLTNYAISEKSDVYSYGMVLLEIIGGRKSYDPSEISEKAHFPSFAFKKLEEGDLQDIFDAKLKYNDKDGRVETAIKVALWCIQDDFYQRPSMSKVVQMLEGVCEVLQPPV

HMMPfam: PF00069
IPR000719
525-789 Pkinase,Ser-thr
Protein kinase, catalytic domain

NKLGQGGFGSVYLGTLPDGSRIAVKKLEGIGQGKKEFRSEVTIIGSIHHIHLVKLRGFCTEGPHRLLAYEYMANGSLDKWIFHSKEDDHLLDWDTRFNIALGTAKGLAYLHQDCDSKIVHCDIKPENVLLDDNFIAKVSDFGLAKLMTREQSHVFTTLRGTHGYLAPEWLTNYAISEKSDVYSYGMVLLEIIGGRKSYDPSEISEKAHFPSFAFKKLEEGDLQDIFDAKLKYNDKDGRVETAIKVALWCIQDDFYQRPSMSKVVQ

PatternScan: PS00107
IPR017441
527-550 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGSVYLGTLPDGSRIAVKK

Gene3D: G3DSA:1.10.510.10
598-804 G3DSA:1.10.510.10

NGSLDKWIFHSKEDDHLLDWDTRFNIALGTAKGLAYLHQDCDSKIVHCDIKPENVLLDDNFIAKVSDFGLAKLMTREQSHVFTTLRGTHGYLAPEWLTNYAISEKSDVYSYGMVLLEIIGGRKSYDPSEISEKAHFPSFAFKKLEEGDLQDIFDAKLKYNDKDGRVETAIKVALWCIQDDFYQRPSMSKVVQMLEGVCEVLQPPVSS

PatternScan: PS00108
IPR008271
642-654 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHCDIKPENVLL


Diseases

Disease Pathogen Avirulence gene
Rice blast disease

List of References

Xuewei Chen, Junjun Shang, Dexi Chen, Cailin Lei, Yan Zou, Wenxue Zhai, Guozhen Liu, Jichen Xu, Zhongzhuan Ling, Gang Cao, Bingtian Ma, Yuping Wang, Xianfeng Zhao, Shigui Li, Lihuang Zhu
A B-lectin receptor kinase gene conferring rice blast resistance.
Plant J.: 2006, 46(5);794-804
PubMed:16709195 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox