PRGDB00061456 (Rdg2a)

From PRG Wiki
Jump to: navigation, search
Rdg2a
Gene Type Reference_R-Genes,_manually_curated
GenBank 301015479 (HM124452)
Gene Class CNL
Domain Type NBS, LRR, Others
Chromosome 1
Gene Species Hordeum vulgare subsp. vulgare

Comment?

Hordeum vulgare subsp. vulgare cultivar Thibaut RDG2A (Rdg2) gene, Rdg2-a allele, complete cds; retrotransposon HORPIA2, complete sequence; and NBS2-RDG2A (Nbs2-Rdg2a) and NBS3-RDG2A (Nbs3-Rdg2a) genes, complete cds.

DNA Sequence

ATGGCAGAGTCACTCCTTCTCCCTCTAGTGCGCGGCGTGGCCGGCAAGGCTGCAGATGCACTTGTCGAGACGGTGACCCGCATGTGTGGCCTCGACGACGACCGTCAAACGCTCGAACGGCATCTACTAGCCGTCGAGTGCAAGCTGGTCAACGCTGAGGAGATGAGCGAGACAAATCGCTATGTCAAGAGCTGGATGAAGGAGCTCAAGTCCGTCGCCTACCTGGCCGACGACGTGCTCGACGACTTCCAGTATGAGGCACTGCGCCGTGAGTCAAAGATTGGCAAGTCCACTACCCGAAAGGCACTCAGCTACATCACGCGCCACAGCCCGCTGCTCTTCCGTTTTGAAATGAGCAGGAAACTCAAGAACGTCCTTAAGAAGATCAATAAGTTGGTTAAGGAGATGAACACGTTTGGCCTGGAGAGTTCTGTCCGTAGGGAGGAGCGGCAACATCCTTGGCGGCAGACGCACTCAAAACTGGACGAAACTACCCAGATCTTTGGAAGGGAAGATGATAAGGAAGTGGTGGTGAAGTTGCTGCTGGACCAGCAGGATCAGCGGAGGGTGCAGGTGCTGCCCATCATTGGGATGGGAGGTCTTGGCAAGACGACTCTTGCTAAGATGGTCTATAATGACCAAGGGGTCGAGCAACATTTCGAGTTGAAGATGTGGCACTGCGTGTCAGACAACTTTGATGCCATTGCTCTTTTGAAATCCATCATTGAGTTGGCTACAAATGGAAGTTGTGACCTGCCTGGCAGCATCGAACTATTGCAAAAGAAACTTGAGCAAGTCATTGGCCAAAAAAGGTTCATGCTCGTGCTTGATGATGTATGGAATGAAGATGAGAGGAAGTGGGGGGATGTCCTGAAGCCACTATTGTGTTCTGTTGGTGGACCAGGAAGTGTTATATTGGTCACATGTCGAAGCAAGCAAGTCGCCTCGATAATGTGCACCGTTACGCCCCATGAGCTAGTATTTCTGAATGAGGAAGATTCATGGGAATTGTTTTCAGACAAAGCGTTTAGCAATGGTGTAGAGGAGCAAGCAGAGTTGGTCAGCATCGGAAGGCGTATTGTCAACAAATGCGGGGGGTTGCCTCTTGCTCTCAAGACAATGGGTGGATTGCTGAGTTCAAAGCAAAAGGTACAGGAATGGAAGGCCATCGAAGAAAGTAACATCGGGGATAAAGATGGAGGCAAATATGAGGTCATGCACATACTGAAGTTAAGCTACAAACACCTGTCGCCTGAAATGAAGCAATGTTTTGCATTCTGTGCAGTTTTTCCCAAGGATTATGAGATGGAGAAGGATAGGTTGATCCAACTATGGATGGCAAATGGCTTTATTCAACACAAGGGAACAATGGATTTAGTACAGAAAGGAGAATTAATTTTTGATGAGTTGGTTTGGAGGTCCTTCCTCCAAGATAAGAAAGTGGCAGTCAGATTTACTAGCTATCGTGGTAACAAAATATATGAGACAATTGTATGTAAAATGCATGATTTAATGCATGATCTAGCAAAAGATGTCACAGATGAATGTGCAAGTATAGAAGAAGTGACTCAGCAGAAAACATTGTTAAAAGATGTTTGTCACATGCAAGTGTCAAAGACTGAATTGGAACAAATCAGTGGGTTATGCAAAGGCAGAACAATCCTACGCACTTTGTTAGTTCCTTCAGGATCACACAAGGATTTTAAAGAGTTGCTACAGGTATCGGCATCACTAAGAGCATTGTGTTGGCCCTCTTATTCAGTTGTCATTTCCAAGGCCATAAATGCAAAACATTTACGGTATCTTGACCTCTCTGGGTCAGACATTGTTAGATTGCCAGATTCAATATGGGTGTTGTATAACCTGCAAACACTGAGGCTAATGGATTGCCGGAAGTTGCGACAGTTACCAGAAGACATGGCAAGATTAAGAAAGCTCATCCATCTTTACCTTTCTGGCTGTGAGAGTCTCAAAAGTATGTCTCCAAACTTTGGTCTGCTGAACAACCTTCACATATTAACAACATTTGTTGTGGGTACCGGAGATGGCCTTGGAATAGAGCAGCTCAAAGATTTGCAAAACCTTAGCAATAGGTTGGAAATATTGAATATGGACAAGATAAAGAGTGGGGAGAATGCAAAAGAAGCCAATCTCAGTCAGAAGCAAAATCTAAGTGAGTTGTTGTTCTCTTGGGGCCAAAAAATAGATGATGAGCCTACAGATGTGGAAGAAGTGCTTCAGGGCTTAGAACCTCATAGTAATATCCAAAAACTGGAGATACGTGGATATCATGGCCTAGAAATATCACAATGGATGAGAAAGCCTCAGATGTTTGACTGCTTGAGAGAACTCGAAATGTTTGGCTGCCCAAAATGCAAGAGTATCCCTGTAATATGGTTCTCGGTCTCTCTAGAGATTTTGGTCTTACAGAGCATGGATAACCTGACAACATTATGTAGTAACCTTGGTGTGGAAGCTGGAGGAAGCATTACCCCTCTGCAACTTTTCCCAAATTTGAAGAAGTTGTGTTTGATTAAGTTACCAAGCCTGGAGATATGGGCAGAAAATAGTGTAGGAGAGCCTCGGATGTTTAGCAGTTTGGAAAAACTCGAAATTTCCGACTGCCCAAGATGCAAGAGTATACCTGCAGTATGGTTTTCGGTCTCTCTTGAGTTTTTGGTCTTACGGAAAATGGATAACCTGACAACATTATGTAATAACCTTGATGTGGAAGCTGGAGGATGCATTACCCCTATGCAGATTTTCCCAAGGTTGAAGAAGATGAGGTTGATTGAGTTACCAAGCCTGGAGATGTGGGCAGAAAATAGTATGGGAGAGCCTAGTTGTGATAACCTGGTAACATTCCCGATGCTTGAAGAGCTAGAGATCAAAAATTGCCCCAAGCTTGCAAGTATTCCAGCGATTCCCGTTGTCAGCGAGTTGAGAATAGTTGGAGTTCACAGTACTGCAGTCGGTTCAGTTTTTATGAGCATCCGTTTGGGCTCCTGGCCATTTCTCGTCAGGTTAAGTCTTGGGTCTCTAGAAGACATACCCATGTTGCCTCTAGACGCCCAGCAAAACCAAAGTGAAAGACCTCTTGAAAAGCTTGAGAGTTTGACTCTGGAAGGGCCCAACAGCTTGATCAGAAGCTCTGGATTGTCCGGATCACAACTTATGGTTTGGAAATGTTTTCGGTTCGTGCGAGATCTGATGATTGATGGTTGCAGCAATCTTGTCCGCTGGCCAACAGTGGAGCTCTGGTGCATGGATCGCCTCTGCATTCTGTGTATCACAAATTGTGACTACCTGAAGGGGAACATTTCATCATCCGAGGAGAAAACCCTTCCGCTGTCCCTGGAGCATTTGACGATTCAGAACTGCCGCAGTGTAGTAGCACTGCCTTCGAACCTTGGGAAACTGGCCAAGCTGAGGAGTCTCTATGTGAGCGACTGCAGGAGCCTGAAAGTGCTGCCTGATGGGATGTGTGGCCTCACTTCTCTGAGGGAATTGGAGATTTGGGGTTGTCCAGGTATGGAGGAATTCCCGCATGGTCTCCTGGAGCGGTTGCCAGCCCTCGAATACTGTAGCATCCATCTCTGCCCGGAGTTGCAAAGACGATGCAGAGAAGGTGGGGAGTACTTCCACTTGCTCTCCTCTGTTCCACGTAAATACTTTGAGAGAATAGGCATCCCAAAGTGA


Protein sequences

Name Description Sequence
RDG2A RDG2A [Hordeum vulgare subsp. vulgare].

MAESLLLPLVRGVAGKAADALVETVTRMCGLDDDRQTLERHLLAVECKLVNAEEMSETNRYVKSWMKELKSVAYLADDVLDDFQYEALRRESKIGKSTTRKALSYITRHSPLLFRFEMSRKLKNVLKKINKLVKEMNTFGLESSVRREERQHPWRQTHSKLDETTQIFGREDDKEVVVKLLLDQQDQRRVQVLPIIGMGGLGKTTLAKMVYNDQGVEQHFELKMWHCVSDNFDAIALLKSIIELATNGSCDLPGSIELLQKKLEQVIGQKRFMLVLDDVWNEDERKWGDVLKPLLCSVGGPGSVILVTCRSKQVASIMCTVTPHELVFLNEEDSWELFSDKAFSNGVEEQAELVSIGRRIVNKCGGLPLALKTMGGLLSSKQKVQEWKAIEESNIGDKDGGKYEVMHILKLSYKHLSPEMKQCFAFCAVFPKDYEMEKDRLIQLWMANGFIQHKGTMDLVQKGELIFDELVWRSFLQDKKVAVRFTSYRGNKIYETIVCKMHDLMHDLAKDVTDECASIEEVTQQKTLLKDVCHMQVSKTELEQISGLCKGRTILRTLLVPSGSHKDFKELLQVSASLRALCWPSYSVVISKAINAKHLRYLDLSGSDIVRLPDSIWVLYNLQTLRLMDCRKLRQLPEDMARLRKLIHLYLSGCESLKSMSPNFGLLNNLHILTTFVVGTGDGLGIEQLKDLQNLSNRLEILNMDKIKSGENAKEANLSQKQNLSELLFSWGQKIDDEPTDVEEVLQGLEPHSNIQKLEIRGYHGLEISQWMRKPQMFDCLRELEMFGCPKCKSIPVIWFSVSLEILVLQSMDNLTTLCSNLGVEAGGSITPLQLFPNLKKLCLIKLPSLEIWAENSVGEPRMFSSLEKLEISDCPRCKSIPAVWFSVSLEFLVLRKMDNLTTLCNNLDVEAGGCITPMQIFPRLKKMRLIELPSLEMWAENSMGEPSCDNLVTFPMLEELEIKNCPKLASIPAIPVVSELRIVGVHSTAVGSVFMSIRLGSWPFLVRLSLGSLEDIPMLPLDAQQNQSERPLEKLESLTLEGPNSLIRSSGLSGSQLMVWKCFRFVRDLMIDGCSNLVRWPTVELWCMDRLCILCITNCDYLKGNISSSEEKTLPLSLEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGCPGMEEFPHGLLERLPALEYCSIHLCPELQRRCREGGEYFHLLSSVPRKYFERIGIPK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
6-1219 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLPLVRGVAGKAADALVETVTRMCGLDDDRQTLERHLLAVECKLVNAEEMSETNRYVKSWMKELKSVAYLADDVLDDFQYEALRRESKIGKSTTRKALSYITRHSPLLFRFEMSRKLKNVLKKINKLVKEMNTFGLESSVRREERQHPWRQTHSKLDETTQIFGREDDKEVVVKLLLDQQDQRRVQVLPIIGMGGLGKTTLAKMVYNDQGVEQHFELKMWHCVSDNFDAIALLKSIIELATNGSCDLPGSIELLQKKLEQVIGQKRFMLVLDDVWNEDERKWGDVLKPLLCSVGGPGSVILVTCRSKQVASIMCTVTPHELVFLNEEDSWELFSDKAFSNGVEEQAELVSIGRRIVNKCGGLPLALKTMGGLLSSKQKVQEWKAIEESNIGDKDGGKYEVMHILKLSYKHLSPEMKQCFAFCAVFPKDYEMEKDRLIQLWMANGFIQHKGTMDLVQKGELIFDELVWRSFLQDKKVAVRFTSYRGNKIYETIVCKMHDLMHDLAKDVTDECASIEEVTQQKTLLKDVCHMQVSKTELEQISGLCKGRTILRTLLVPSGSHKDFKELLQVSASLRALCWPSYSVVISKAINAKHLRYLDLSGSDIVRLPDSIWVLYNLQTLRLMDCRKLRQLPEDMARLRKLIHLYLSGCESLKSMSPNFGLLNNLHILTTFVVGTGDGLGIEQLKDLQNLSNRLEILNMDKIKSGENAKEANLSQKQNLSELLFSWGQKIDDEPTDVEEVLQGLEPHSNIQKLEIRGYHGLEISQWMRKPQMFDCLRELEMFGCPKCKSIPVIWFSVSLEILVLQSMDNLTTLCSNLGVEAGGSITPLQLFPNLKKLCLIKLPSLEIWAENSVGEPRMFSSLEKLEISDCPRCKSIPAVWFSVSLEFLVLRKMDNLTTLCNNLDVEAGGCITPMQIFPRLKKMRLIELPSLEMWAENSMGEPSCDNLVTFPMLEELEIKNCPKLASIPAIPVVSELRIVGVHSTAVGSVFMSIRLGSWPFLVRLSLGSLEDIPMLPLDAQQNQSERPLEKLESLTLEGPNSLIRSSGLSGSQLMVWKCFRFVRDLMIDGCSNLVRWPTVELWCMDRLCILCITNCDYLKGNISSSEEKTLPLSLEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGCPGMEEFPHGLLERLPALEYCSIHLCPELQRRCREGGEYFHLLSS

HMMPanther: PTHR23155:SF182
6-1219 PTHR23155:SF182,OS08G0543500 PROTEIN

LLPLVRGVAGKAADALVETVTRMCGLDDDRQTLERHLLAVECKLVNAEEMSETNRYVKSWMKELKSVAYLADDVLDDFQYEALRRESKIGKSTTRKALSYITRHSPLLFRFEMSRKLKNVLKKINKLVKEMNTFGLESSVRREERQHPWRQTHSKLDETTQIFGREDDKEVVVKLLLDQQDQRRVQVLPIIGMGGLGKTTLAKMVYNDQGVEQHFELKMWHCVSDNFDAIALLKSIIELATNGSCDLPGSIELLQKKLEQVIGQKRFMLVLDDVWNEDERKWGDVLKPLLCSVGGPGSVILVTCRSKQVASIMCTVTPHELVFLNEEDSWELFSDKAFSNGVEEQAELVSIGRRIVNKCGGLPLALKTMGGLLSSKQKVQEWKAIEESNIGDKDGGKYEVMHILKLSYKHLSPEMKQCFAFCAVFPKDYEMEKDRLIQLWMANGFIQHKGTMDLVQKGELIFDELVWRSFLQDKKVAVRFTSYRGNKIYETIVCKMHDLMHDLAKDVTDECASIEEVTQQKTLLKDVCHMQVSKTELEQISGLCKGRTILRTLLVPSGSHKDFKELLQVSASLRALCWPSYSVVISKAINAKHLRYLDLSGSDIVRLPDSIWVLYNLQTLRLMDCRKLRQLPEDMARLRKLIHLYLSGCESLKSMSPNFGLLNNLHILTTFVVGTGDGLGIEQLKDLQNLSNRLEILNMDKIKSGENAKEANLSQKQNLSELLFSWGQKIDDEPTDVEEVLQGLEPHSNIQKLEIRGYHGLEISQWMRKPQMFDCLRELEMFGCPKCKSIPVIWFSVSLEILVLQSMDNLTTLCSNLGVEAGGSITPLQLFPNLKKLCLIKLPSLEIWAENSVGEPRMFSSLEKLEISDCPRCKSIPAVWFSVSLEFLVLRKMDNLTTLCNNLDVEAGGCITPMQIFPRLKKMRLIELPSLEMWAENSMGEPSCDNLVTFPMLEELEIKNCPKLASIPAIPVVSELRIVGVHSTAVGSVFMSIRLGSWPFLVRLSLGSLEDIPMLPLDAQQNQSERPLEKLESLTLEGPNSLIRSSGLSGSQLMVWKCFRFVRDLMIDGCSNLVRWPTVELWCMDRLCILCITNCDYLKGNISSSEEKTLPLSLEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGCPGMEEFPHGLLERLPALEYCSIHLCPELQRRCREGGEYFHLLSS

superfamily: SSF52540
149-393 SSF52540

ERQHPWRQTHSKLDETTQIFGREDDKEVVVKLLLDQQDQRRVQVLPIIGMGGLGKTTLAKMVYNDQGVEQHFELKMWHCVSDNFDAIALLKSIIELATNGSCDLPGSIELLQKKLEQVIGQKRFMLVLDDVWNEDERKWGDVLKPLLCSVGGPGSVILVTCRSKQVASIMCTVTPHELVFLNEEDSWELFSDKAFSNGVEEQAELVSIGRRIVNKCGGLPLALKTMGGLLSSKQKVQEWKAIEES

Gene3D: G3DSA:3.40.50.300
168-298 G3DSA:3.40.50.300

FGREDDKEVVVKLLLDQQDQRRVQVLPIIGMGGLGKTTLAKMVYNDQGVEQHFELKMWHCVSDNFDAIALLKSIIELATNGSCDLPGSIELLQKKLEQVIGQKRFMLVLDDVWNEDERKWGDVLKPLLCSV

HMMPfam: PF00931
IPR002182
170-453 NB-ARC,NBS
NB-ARC

REDDKEVVVKLLLDQQDQRRVQVLPIIGMGGLGKTTLAKMVYNDQGVEQHFELKMWHCVSDNFDAIALLKSIIELATNGSCDLPGSIELLQKKLEQVIGQKRFMLVLDDVWNEDERKWGDVLKPLLCSVGGPGSVILVTCRSKQVASIMCTVTPHELVFLNEEDSWELFSDKAFSNGVEEQAELVSIGRRIVNKCGGLPLALKTMGGLLSSKQKVQEWKAIEESNIGDKDGGKYEVMHILKLSYKHLSPEMKQCFAFCAVFPKDYEMEKDRLIQLWMANGFIQH

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VLPIIGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

VIGQKRFMLVLDDVW

FPrintScan: PR00364
IPR000767
364-378 DISEASERSIST
Disease resistance protein

CGGLPLALKTMGGLL

superfamily: SSF52058
500-990 SSF52058,LRR

KMHDLMHDLAKDVTDECASIEEVTQQKTLLKDVCHMQVSKTELEQISGLCKGRTILRTLLVPSGSHKDFKELLQVSASLRALCWPSYSVVISKAINAKHLRYLDLSGSDIVRLPDSIWVLYNLQTLRLMDCRKLRQLPEDMARLRKLIHLYLSGCESLKSMSPNFGLLNNLHILTTFVVGTGDGLGIEQLKDLQNLSNRLEILNMDKIKSGENAKEANLSQKQNLSELLFSWGQKIDDEPTDVEEVLQGLEPHSNIQKLEIRGYHGLEISQWMRKPQMFDCLRELEMFGCPKCKSIPVIWFSVSLEILVLQSMDNLTTLCSNLGVEAGGSITPLQLFPNLKKLCLIKLPSLEIWAENSVGEPRMFSSLEKLEISDCPRCKSIPAVWFSVSLEFLVLRKMDNLTTLCNNLDVEAGGCITPMQIFPRLKKMRLIELPSLEMWAENSMGEPSCDNLVTFPMLEELEIKNCPKLASIPAIPVVSELRIVGVHSTA

Gene3D: G3DSA:3.80.10.10
519-692 G3DSA:3.80.10.10

IEEVTQQKTLLKDVCHMQVSKTELEQISGLCKGRTILRTLLVPSGSHKDFKELLQVSASLRALCWPSYSVVISKAINAKHLRYLDLSGSDIVRLPDSIWVLYNLQTLRLMDCRKLRQLPEDMARLRKLIHLYLSGCESLKSMSPNFGLLNNLHILTTFVVGTGDGLGIEQLKDL

HMMPfam: PF00560
IPR001611
598-617 LRR_1
Leucine-rich repeat

HLRYLDLSGSDIVRLPDSIW

HMMPfam: PF13504
621-637 LRR_7,Leucine rich repeat

NLQTLRLMDCRKLRQLP

FPrintScan: PR00364
IPR000767
641-657 DISEASERSIST
Disease resistance protein

ARLRKLIHLYLSGCESL

HMMPfam: PF00560
IPR001611
645-665 LRR_1
Leucine-rich repeat

KLIHLYLSGCESLKSMSPNFG

Gene3D: G3DSA:3.80.10.10
693-804 G3DSA:3.80.10.10

QNLSNRLEILNMDKIKSGENAKEANLSQKQNLSELLFSWGQKIDDEPTDVEEVLQGLEPHSNIQKLEIRGYHGLEISQWMRKPQMFDCLRELEMFGCPKCKSIPVIWFSVSL

Gene3D: G3DSA:3.80.10.10
888-903 G3DSA:3.80.10.10

VSLEFLVLRKMDNLTT

superfamily: SSF52047
915-1182 SSF52047,LRR

CITPMQIFPRLKKMRLIELPSLEMWAENSMGEPSCDNLVTFPMLEELEIKNCPKLASIPAIPVVSELRIVGVHSTAVGSVFMSIRLGSWPFLVRLSLGSLEDIPMLPLDAQQNQSERPLEKLESLTLEGPNSLIRSSGLSGSQLMVWKCFRFVRDLMIDGCSNLVRWPTVELWCMDRLCILCITNCDYLKGNISSSEEKTLPLSLEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGCPGMEEFP

Gene3D: G3DSA:3.80.10.10
947-975 G3DSA:3.80.10.10

PSCDNLVTFPMLEELEIKNCPKLASIPAI

Gene3D: G3DSA:3.80.10.10
1066-1203 G3DSA:3.80.10.10

FVRDLMIDGCSNLVRWPTVELWCMDRLCILCITNCDYLKGNISSSEEKTLPLSLEHLTIQNCRSVVALPSNLGKLAKLRSLYVSDCRSLKVLPDGMCGLTSLRELEIWGCPGMEEFPHGLLERLPALEYCSIHLCPEL


Diseases

Disease Pathogen Avirulence gene
Seed borne disease

List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox