PRGDB00061457 (Pid3)

From PRG Wiki
Jump to: navigation, search
Pid3
Gene Type Reference_R-Genes,_manually_curated
GenBank 225030801 (FJ773286)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group cultivar Nipponbare resistance protein Pid3 gene, complete cds.

DNA Sequence

ATGGCGGAGGGTGTTGTGGGCTCACTAATCGTCAAGCTTGGGGATGCCCTGGCGAGTGAAGCAGTGGAGGTCGCCAAGTCCTTGCTTGGGCTAGAGGGATCTGCTCTGAAGCGCCTCTTTTCTGAGATCCGGGAGGTGAAGGGGGAGCTGGAGAGCATCCATGCCTTCTTGCAGGCAGCCGAGCGGTTCAAGGACGCCGACGAGACAACCTCCGCGTTCGTCAAGCAGGTGAGGAGCCTCGCCCTGAGCATCGAGGACGTAGTCGATGAGTTCACCTACGAGCTGGGGGAAGGAGACGGCCGGATGGGGATGGCAGTGGCACTCAAGAGGATGTGCAAGATGGGCACATGGTCTCGCCTGGCTGGCAATCTGCAGGACATCAAGGTCAACCTGAAAAACGCTGCCGAGAGGAGGATTAGGTATGATCTGAAGGGCGTCGAGAGAGGCGCGAAATCGATGGCGGGAAGGAGGAGCTCAAACTGGAGATCTGACTCTGTACTCTTCAAGAGGGAGGATGAGCTTGTTGGTATCGAGAAGAAGAGGGATTTGCTGATGAAATGGGTGAAAGATGAGGAGCAGCGCCGCATGGTGGTCAGTGTGTGGGGAATGAGTGGAATCGGCAAGACGGCACTGGTTGCTAATGTTTACAATGCTATCAAGGCTGACTTTGACACCTGTGCTTGGATCACTGTGTCTCAGAGCTACGAGGCTGACGATTTGCTTAGGCGAACTGCTCAAGAGTTTCGCAAGAATGATCGGAAGAAAGACTTCCCAATTGACGTTGATATCACAAATTACAGAGGCTTGGTCGAAACCACCCGCTCTTACCTGGAGAACAAAAGGTATGTCCTTGTCCTAGATGATGTATGGAATGCAAATGTTTGGTTCGATAGCAAAGATGCATTTGAAGATGGCAATATTGGCCGAATAATTCTTACATCAAGGAATTATGATGTGGCGTTACTTGCGCATGAAACCCATATAATTAATTTGCAGCCGTTGGAGAAACACCATGCGTGGGATCTGTTCTGTAAAGAGGCATTTTGGAAGAATGAGATAAGGAATTGTCCGCCGGAGTTGCAGCCCTGGGCTAATAATTTTGTTGACAAGTGCAATGGCTTGCCAATCGCAATTGTGTGCATTGGACGCCTTCTGTCATTTCAAGGGTCAACTTATTCAGACTGGGAAAAGGTGTACAAAAATCTTGAGATGCAACTAACAAACAACTCTATCATGGACATGATGAACATTATCTTGAAGATTAGTTTGGAAGATCTACCGCACAACATTAAGAACTGCTTCCTTTATTGCTCCATGTTTCCTGAAAATTATGTGATGAAGAGGAAGTCCCTAGTACGACTCTGGGTTGCTGAAGGATTTATTGAAGAAACTGAGCATAGAACACTTGAGGAAGTGGCAGAGCATTACTTGACTGAACTTGTGAACCGATGTCTTCTGTTGCTGGTGAAGAGAAATGAGGCTGGACATGTTCATGAAGTCCAAATGCACGATATCCTCCGTGTTTTGGCTCTTTCCAAGGCTCATGAACAAAATTTTTGCATTGTCGTTAACCACTCGAGGAGTACACATCTTATTGGAGAAGCACGCCGTTTATCAATTCAGAGAGGGGATTTTGCACAACTTGCAGACCATGCACCACATCTTCGATCCTTGCTGCTTTTCCAAAGTTCACCCAATGTCAGTTCGCTTCAGTCATTACCAAAGTCTATGAAGTTGTTGTCTGTTTTGGATCTAACTGATAGTTCAGTTGATAGGCTGCCAAAGGAAGTGTTTGGCTTGTTCAACTTGCGTTTTCTGGGTCTCAGGCGTACTAAAATCTCCAAGCTTCCAAGCTCCATTGGAAGGCTAAAAATTCTGCTGGTGTTGGACGCTTGGAAGTGTAAAATTGTAAAGCTTCCATTGGCGATTACAAAACTTCAAAAGCTAACACATCTTATTGTAACTTCGAAAGCAGTCGTTGTTTCTAAGCAATTTGTTCCTTCTTTTGATGTGCCAGCACCTTTGCGTATCTGCTCCATGACAACCCTTCAGACATTACTACTCATGGAAGCTAGTTCTCAAATGGTTCATCACCTAGGCTCTCTTGTGGAGTTAAGAACCTTTCGTATCAGCAAGGTGCGAAGTTGCCATTGTGAGCAGTTGTTCATGGCCATCACTAATATGATTCATCTTACCCGTCTTGGGATCTAG


Protein sequences

Name Description Sequence
resistance protein Pid3 resistance protein Pid3 [Oryza sativa Japonica Group].

MAEGVVGSLIVKLGDALASEAVEVAKSLLGLEGSALKRLFSEIREVKGELESIHAFLQAAERFKDADETTSAFVKQVRSLALSIEDVVDEFTYELGEGDGRMGMAVALKRMCKMGTWSRLAGNLQDIKVNLKNAAERRIRYDLKGVERGAKSMAGRRSSNWRSDSVLFKREDELVGIEKKRDLLMKWVKDEEQRRMVVSVWGMSGIGKTALVANVYNAIKADFDTCAWITVSQSYEADDLLRRTAQEFRKNDRKKDFPIDVDITNYRGLVETTRSYLENKRYVLVLDDVWNANVWFDSKDAFEDGNIGRIILTSRNYDVALLAHETHIINLQPLEKHHAWDLFCKEAFWKNEIRNCPPELQPWANNFVDKCNGLPIAIVCIGRLLSFQGSTYSDWEKVYKNLEMQLTNNSIMDMMNIILKISLEDLPHNIKNCFLYCSMFPENYVMKRKSLVRLWVAEGFIEETEHRTLEEVAEHYLTELVNRCLLLLVKRNEAGHVHEVQMHDILRVLALSKAHEQNFCIVVNHSRSTHLIGEARRLSIQRGDFAQLADHAPHLRSLLLFQSSPNVSSLQSLPKSMKLLSVLDLTDSSVDRLPKEVFGLFNLRFLGLRRTKISKLPSSIGRLKILLVLDAWKCKIVKLPLAITKLQKLTHLIVTSKAVVVSKQFVPSFDVPAPLRICSMTTLQTLLLMEASSQMVHHLGSLVELRTFRISKVRSCHCEQLFMAITNMIHLTRLGI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF153
10-711 PTHR23155:SF153,OS06G0330100 PROTEIN

IVKLGDALASEAVEVAKSLLGLEGSALKRLFSEIREVKGELESIHAFLQAAERFKDADETTSAFVKQVRSLALSIEDVVDEFTYELGEGDGRMGMAVALKRMCKMGTWSRLAGNLQDIKVNLKNAAERRIRYDLKGVERGAKSMAGRRSSNWRSDSVLFKREDELVGIEKKRDLLMKWVKDEEQRRMVVSVWGMSGIGKTALVANVYNAIKADFDTCAWITVSQSYEADDLLRRTAQEFRKNDRKKDFPIDVDITNYRGLVETTRSYLENKRYVLVLDDVWNANVWFDSKDAFEDGNIGRIILTSRNYDVALLAHETHIINLQPLEKHHAWDLFCKEAFWKNEIRNCPPELQPWANNFVDKCNGLPIAIVCIGRLLSFQGSTYSDWEKVYKNLEMQLTNNSIMDMMNIILKISLEDLPHNIKNCFLYCSMFPENYVMKRKSLVRLWVAEGFIEETEHRTLEEVAEHYLTELVNRCLLLLVKRNEAGHVHEVQMHDILRVLALSKAHEQNFCIVVNHSRSTHLIGEARRLSIQRGDFAQLADHAPHLRSLLLFQSSPNVSSLQSLPKSMKLLSVLDLTDSSVDRLPKEVFGLFNLRFLGLRRTKISKLPSSIGRLKILLVLDAWKCKIVKLPLAITKLQKLTHLIVTSKAVVVSKQFVPSFDVPAPLRICSMTTLQTLLLMEASSQMVHHLGSLVELRTFRIS

HMMPanther: PTHR23155
10-711 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IVKLGDALASEAVEVAKSLLGLEGSALKRLFSEIREVKGELESIHAFLQAAERFKDADETTSAFVKQVRSLALSIEDVVDEFTYELGEGDGRMGMAVALKRMCKMGTWSRLAGNLQDIKVNLKNAAERRIRYDLKGVERGAKSMAGRRSSNWRSDSVLFKREDELVGIEKKRDLLMKWVKDEEQRRMVVSVWGMSGIGKTALVANVYNAIKADFDTCAWITVSQSYEADDLLRRTAQEFRKNDRKKDFPIDVDITNYRGLVETTRSYLENKRYVLVLDDVWNANVWFDSKDAFEDGNIGRIILTSRNYDVALLAHETHIINLQPLEKHHAWDLFCKEAFWKNEIRNCPPELQPWANNFVDKCNGLPIAIVCIGRLLSFQGSTYSDWEKVYKNLEMQLTNNSIMDMMNIILKISLEDLPHNIKNCFLYCSMFPENYVMKRKSLVRLWVAEGFIEETEHRTLEEVAEHYLTELVNRCLLLLVKRNEAGHVHEVQMHDILRVLALSKAHEQNFCIVVNHSRSTHLIGEARRLSIQRGDFAQLADHAPHLRSLLLFQSSPNVSSLQSLPKSMKLLSVLDLTDSSVDRLPKEVFGLFNLRFLGLRRTKISKLPSSIGRLKILLVLDAWKCKIVKLPLAITKLQKLTHLIVTSKAVVVSKQFVPSFDVPAPLRICSMTTLQTLLLMEASSQMVHHLGSLVELRTFRIS

superfamily: SSF52540
153-409 SSF52540

MAGRRSSNWRSDSVLFKREDELVGIEKKRDLLMKWVKDEEQRRMVVSVWGMSGIGKTALVANVYNAIKADFDTCAWITVSQSYEADDLLRRTAQEFRKNDRKKDFPIDVDITNYRGLVETTRSYLENKRYVLVLDDVWNANVWFDSKDAFEDGNIGRIILTSRNYDVALLAHETHIINLQPLEKHHAWDLFCKEAFWKNEIRNCPPELQPWANNFVDKCNGLPIAIVCIGRLLSFQGSTYSDWEKVYKNLEMQLTNN

Gene3D: G3DSA:3.40.50.300
172-292 G3DSA:3.40.50.300

DELVGIEKKRDLLMKWVKDEEQRRMVVSVWGMSGIGKTALVANVYNAIKADFDTCAWITVSQSYEADDLLRRTAQEFRKNDRKKDFPIDVDITNYRGLVETTRSYLENKRYVLVLDDVWNA

HMMPfam: PF00931
IPR002182
182-464 NB-ARC,NBS
NB-ARC

DLLMKWVKDEEQRRMVVSVWGMSGIGKTALVANVYNAIKADFDTCAWITVSQSYEADDLLRRTAQEFRKNDRKKDFPIDVDITNYRGLVETTRSYLENKRYVLVLDDVWNANVWFDSKDAFEDGNIGRIILTSRNYDVALLAHETHIINLQPLEKHHAWDLFCKEAFWKNEIRNCPPELQPWANNFVDKCNGLPIAIVCIGRLLSFQGSTYSDWEKVYKNLEMQLTNNSIMDMMNIILKISLEDLPHNIKNCFLYCSMFPENYVMKRKSLVRLWVAEGFIEET

FPrintScan: PR00364
IPR000767
197-212 DISEASERSIST
Disease resistance protein

VVSVWGMSGIGKTALV

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

YLENKRYVLVLDDVW

FPrintScan: PR00364
IPR000767
371-385 DISEASERSIST
Disease resistance protein

CNGLPIAIVCIGRLL

Gene3D: G3DSA:3.80.10.10
539-734 G3DSA:3.80.10.10

SIQRGDFAQLADHAPHLRSLLLFQSSPNVSSLQSLPKSMKLLSVLDLTDSSVDRLPKEVFGLFNLRFLGLRRTKISKLPSSIGRLKILLVLDAWKCKIVKLPLAITKLQKLTHLIVTSKAVVVSKQFVPSFDVPAPLRICSMTTLQTLLLMEASSQMVHHLGSLVELRTFRISKVRSCHCEQLFMAITNMIHLTRL

superfamily: SSF52047
552-734 SSF52047,LRR

APHLRSLLLFQSSPNVSSLQSLPKSMKLLSVLDLTDSSVDRLPKEVFGLFNLRFLGLRRTKISKLPSSIGRLKILLVLDAWKCKIVKLPLAITKLQKLTHLIVTSKAVVVSKQFVPSFDVPAPLRICSMTTLQTLLLMEASSQMVHHLGSLVELRTFRISKVRSCHCEQLFMAITNMIHLTRL

FPrintScan: PR00364
IPR000767
575-591 DISEASERSIST
Disease resistance protein

KSMKLLSVLDLTDSSVD


Diseases

Disease Pathogen Avirulence gene
Rice blast disease Magnaporthe grisea

List of References

Junjun Shang, Yong Tao, Xuewei Chen, Yan Zou, Cailin Lei, Jing Wang, Xiaobing Li, Xianfeng Zhao, Meijun Zhang, Zhike Lu, Jichen Xu, Zhukuan Cheng, Jianmin Wan, Lihuang Zhu
Identification of a new rice blast resistance gene, Pid3, by genomewide comparison of paired nucleotide-binding site--leucine-rich repeat genes and their pseudogene alleles between the two sequenced rice genomes.
Genetics: 2009, 182(4);1303-11
PubMed:19506306 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox